Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A2G4TAE8

Protein Details
Accession A0A2G4TAE8    Localization Confidence Medium Confidence Score 13.2
NoLS Segment(s)
PositionSequenceProtein Nature
194-224APYTLAHRTNSKKRKNKWNSCKRGKTNGNRLHydrophilic
NLS Segment(s)
PositionSequence
205-210KKRKNK
Subcellular Location(s) nucl 18.5, cyto_nucl 11, mito 3, pero 3
Family & Domain DBs
Amino Acid Sequences MIQTEQVPQDDSEMNFIKRRINLSNWNKGLYLLKKELTGIVMTDKIIGLDPGMNIILKISILTIYIGLRDIFVAMDCSAEQMPDKKTIKENTTKFLMLNTSEMCSGFEWARKVELKNREAAGIQQVYDEIPVVDAANSSEILTYLRIIGRNRKKIFDFMKSYRHHETKAYLVQNRQITDNRMCDLVLGQTAAGAPYTLAHRTNSKKRKNKWNSCKRGKTNGNRL
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.27
2 0.29
3 0.3
4 0.32
5 0.32
6 0.37
7 0.36
8 0.39
9 0.48
10 0.53
11 0.62
12 0.59
13 0.57
14 0.52
15 0.49
16 0.49
17 0.44
18 0.42
19 0.36
20 0.35
21 0.33
22 0.33
23 0.33
24 0.27
25 0.22
26 0.15
27 0.13
28 0.13
29 0.13
30 0.12
31 0.11
32 0.1
33 0.1
34 0.09
35 0.07
36 0.07
37 0.07
38 0.07
39 0.08
40 0.07
41 0.07
42 0.07
43 0.06
44 0.05
45 0.05
46 0.04
47 0.04
48 0.05
49 0.05
50 0.06
51 0.05
52 0.06
53 0.07
54 0.07
55 0.06
56 0.06
57 0.06
58 0.05
59 0.05
60 0.06
61 0.05
62 0.06
63 0.06
64 0.07
65 0.07
66 0.07
67 0.08
68 0.1
69 0.12
70 0.2
71 0.21
72 0.22
73 0.28
74 0.33
75 0.38
76 0.43
77 0.44
78 0.39
79 0.41
80 0.4
81 0.34
82 0.3
83 0.26
84 0.18
85 0.18
86 0.14
87 0.11
88 0.11
89 0.11
90 0.11
91 0.09
92 0.1
93 0.09
94 0.1
95 0.1
96 0.1
97 0.13
98 0.14
99 0.16
100 0.21
101 0.29
102 0.27
103 0.31
104 0.31
105 0.29
106 0.27
107 0.26
108 0.24
109 0.17
110 0.16
111 0.11
112 0.11
113 0.1
114 0.1
115 0.09
116 0.04
117 0.04
118 0.04
119 0.04
120 0.04
121 0.04
122 0.04
123 0.05
124 0.05
125 0.05
126 0.05
127 0.05
128 0.05
129 0.06
130 0.06
131 0.06
132 0.08
133 0.11
134 0.13
135 0.23
136 0.32
137 0.42
138 0.44
139 0.47
140 0.48
141 0.53
142 0.56
143 0.55
144 0.53
145 0.48
146 0.56
147 0.54
148 0.58
149 0.58
150 0.56
151 0.49
152 0.44
153 0.42
154 0.4
155 0.45
156 0.46
157 0.41
158 0.41
159 0.46
160 0.47
161 0.45
162 0.41
163 0.37
164 0.36
165 0.37
166 0.38
167 0.33
168 0.29
169 0.28
170 0.24
171 0.22
172 0.18
173 0.13
174 0.1
175 0.08
176 0.08
177 0.08
178 0.08
179 0.07
180 0.05
181 0.04
182 0.06
183 0.09
184 0.11
185 0.12
186 0.15
187 0.23
188 0.32
189 0.43
190 0.52
191 0.6
192 0.68
193 0.76
194 0.85
195 0.89
196 0.91
197 0.92
198 0.93
199 0.93
200 0.95
201 0.96
202 0.93
203 0.93
204 0.92