Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A2G4T7L1

Protein Details
Accession A0A2G4T7L1    Localization Confidence Medium Confidence Score 14.4
NoLS Segment(s)
PositionSequenceProtein Nature
7-38SINPADALRKKQRKRELKKNKEERKRARESVLBasic
NLS Segment(s)
PositionSequence
14-41LRKKQRKRELKKNKEERKRARESVLAKK
Subcellular Location(s) nucl 23.5, cyto_nucl 13
Family & Domain DBs
InterPro View protein in InterPro  
IPR019007  WW_dom-bd_prot_11  
Gene Ontology GO:0006396  P:RNA processing  
Pfam View protein in Pfam  
PF09429  Wbp11  
Amino Acid Sequences MGKSNRSINPADALRKKQRKRELKKNKEERKRARESVLAKKDVNKVKGEISRLEHLASSGQLSKQDQARLDSLKAEASKIEKAKKVKEIKLSAMQF
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.57
2 0.65
3 0.7
4 0.72
5 0.78
6 0.8
7 0.83
8 0.87
9 0.87
10 0.88
11 0.92
12 0.94
13 0.94
14 0.93
15 0.94
16 0.93
17 0.91
18 0.89
19 0.82
20 0.75
21 0.71
22 0.67
23 0.67
24 0.63
25 0.57
26 0.48
27 0.49
28 0.52
29 0.51
30 0.48
31 0.38
32 0.33
33 0.34
34 0.36
35 0.33
36 0.28
37 0.26
38 0.26
39 0.25
40 0.24
41 0.19
42 0.16
43 0.15
44 0.12
45 0.1
46 0.09
47 0.09
48 0.11
49 0.12
50 0.15
51 0.18
52 0.21
53 0.21
54 0.23
55 0.26
56 0.26
57 0.26
58 0.24
59 0.21
60 0.22
61 0.2
62 0.18
63 0.17
64 0.17
65 0.23
66 0.27
67 0.33
68 0.35
69 0.41
70 0.47
71 0.55
72 0.61
73 0.61
74 0.66
75 0.66
76 0.67