Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

J0WKB0

Protein Details
Accession J0WKB0    Localization Confidence Medium Confidence Score 11.8
NoLS Segment(s)
PositionSequenceProtein Nature
203-228CRVWTRRSGAGPRRVRRKRGGGQEASHydrophilic
NLS Segment(s)
PositionSequence
209-222RSGAGPRRVRRKRG
Subcellular Location(s) nucl 13.5, cyto_nucl 11, cyto 7.5, mito 2, extr 2
Family & Domain DBs
KEGG adl:AURDEDRAFT_118234  -  
Amino Acid Sequences MPGLTAVDLEPHSALIASAFLPQEAAFAGAARDSVWYKAVIPDAIPPDPSQPLPSSQVLQAEVEDYVQHRFSWAAPPIWLTPAGRVAEQGSGSVLLSFSREEDLEYVLRNGVFLFGRALRVPRFRDSGRPRPCSNCCSLEHSARACSQAPRCGLCSGGRLTSEHRCGECDFFDDAHEGLAHCGHTALCCPHCAGSHAMCDSACRVWTRRSGAGPRRVRRKRGGGQEASAMDLS
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.09
2 0.06
3 0.07
4 0.06
5 0.09
6 0.09
7 0.09
8 0.09
9 0.09
10 0.09
11 0.09
12 0.09
13 0.06
14 0.06
15 0.07
16 0.06
17 0.06
18 0.06
19 0.08
20 0.08
21 0.09
22 0.1
23 0.11
24 0.12
25 0.14
26 0.16
27 0.15
28 0.14
29 0.18
30 0.21
31 0.21
32 0.21
33 0.19
34 0.2
35 0.22
36 0.22
37 0.2
38 0.17
39 0.19
40 0.23
41 0.24
42 0.23
43 0.22
44 0.24
45 0.22
46 0.21
47 0.18
48 0.14
49 0.12
50 0.11
51 0.09
52 0.08
53 0.09
54 0.09
55 0.09
56 0.09
57 0.09
58 0.1
59 0.16
60 0.18
61 0.18
62 0.17
63 0.2
64 0.2
65 0.21
66 0.21
67 0.15
68 0.13
69 0.16
70 0.17
71 0.14
72 0.14
73 0.14
74 0.14
75 0.14
76 0.12
77 0.08
78 0.08
79 0.07
80 0.07
81 0.06
82 0.04
83 0.05
84 0.05
85 0.05
86 0.06
87 0.06
88 0.06
89 0.07
90 0.08
91 0.08
92 0.09
93 0.08
94 0.08
95 0.08
96 0.07
97 0.07
98 0.06
99 0.06
100 0.06
101 0.07
102 0.07
103 0.08
104 0.08
105 0.1
106 0.11
107 0.16
108 0.19
109 0.2
110 0.24
111 0.24
112 0.34
113 0.4
114 0.48
115 0.53
116 0.55
117 0.55
118 0.58
119 0.61
120 0.55
121 0.52
122 0.46
123 0.39
124 0.41
125 0.42
126 0.38
127 0.38
128 0.35
129 0.32
130 0.29
131 0.29
132 0.24
133 0.25
134 0.24
135 0.26
136 0.27
137 0.26
138 0.28
139 0.26
140 0.26
141 0.22
142 0.23
143 0.19
144 0.19
145 0.18
146 0.17
147 0.2
148 0.25
149 0.29
150 0.28
151 0.26
152 0.27
153 0.28
154 0.29
155 0.26
156 0.23
157 0.2
158 0.17
159 0.18
160 0.17
161 0.15
162 0.13
163 0.13
164 0.09
165 0.08
166 0.09
167 0.08
168 0.07
169 0.07
170 0.07
171 0.07
172 0.1
173 0.14
174 0.14
175 0.15
176 0.16
177 0.17
178 0.18
179 0.2
180 0.22
181 0.2
182 0.24
183 0.24
184 0.24
185 0.22
186 0.22
187 0.22
188 0.2
189 0.19
190 0.17
191 0.2
192 0.24
193 0.31
194 0.36
195 0.4
196 0.45
197 0.53
198 0.6
199 0.67
200 0.72
201 0.74
202 0.79
203 0.82
204 0.83
205 0.82
206 0.84
207 0.83
208 0.84
209 0.85
210 0.8
211 0.74
212 0.73
213 0.63