Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

J0LF17

Protein Details
Accession J0LF17    Localization Confidence Medium Confidence Score 12
NoLS Segment(s)
PositionSequenceProtein Nature
1-43MSPSVHKRKKAFRRHQADRLHRIPTSWRKPRGIDNRARRRFKGBasic
NLS Segment(s)
PositionSequence
6-46HKRKKAFRRHQADRLHRIPTSWRKPRGIDNRARRRFKGQLP
Subcellular Location(s) nucl 15.5, cyto_nucl 11.5, cyto 6.5, mito 5
Family & Domain DBs
InterPro View protein in InterPro  
IPR001515  Ribosomal_L32e  
IPR018263  Ribosomal_L32e_CS  
IPR036351  Ribosomal_L32e_sf  
Gene Ontology GO:1990904  C:ribonucleoprotein complex  
GO:0005840  C:ribosome  
GO:0003735  F:structural constituent of ribosome  
GO:0006412  P:translation  
KEGG adl:AURDEDRAFT_117352  -  
Pfam View protein in Pfam  
PF01655  Ribosomal_L32e  
PROSITE View protein in PROSITE  
PS00580  RIBOSOMAL_L32E  
CDD cd00513  Ribosomal_L32_L32e  
Amino Acid Sequences MSPSVHKRKKAFRRHQADRLHRIPTSWRKPRGIDNRARRRFKGQLPMPGIGYRTSKKARHVLPNGMQKIRVANARDLELLLMSNKKFQAELAHSLSSKSRVAMLARAHALGITVTNAAARLRSDE
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.88
2 0.9
3 0.89
4 0.89
5 0.87
6 0.8
7 0.74
8 0.64
9 0.56
10 0.56
11 0.56
12 0.57
13 0.57
14 0.59
15 0.59
16 0.62
17 0.7
18 0.71
19 0.7
20 0.69
21 0.71
22 0.75
23 0.81
24 0.83
25 0.75
26 0.72
27 0.7
28 0.67
29 0.66
30 0.61
31 0.6
32 0.59
33 0.57
34 0.51
35 0.45
36 0.39
37 0.3
38 0.28
39 0.2
40 0.21
41 0.25
42 0.26
43 0.3
44 0.37
45 0.4
46 0.46
47 0.5
48 0.51
49 0.53
50 0.59
51 0.57
52 0.5
53 0.45
54 0.36
55 0.33
56 0.28
57 0.25
58 0.19
59 0.18
60 0.19
61 0.2
62 0.2
63 0.18
64 0.16
65 0.12
66 0.1
67 0.08
68 0.1
69 0.09
70 0.12
71 0.12
72 0.12
73 0.12
74 0.12
75 0.18
76 0.2
77 0.26
78 0.27
79 0.29
80 0.28
81 0.29
82 0.3
83 0.27
84 0.23
85 0.18
86 0.15
87 0.16
88 0.17
89 0.22
90 0.23
91 0.25
92 0.26
93 0.25
94 0.23
95 0.21
96 0.19
97 0.14
98 0.12
99 0.08
100 0.07
101 0.07
102 0.07
103 0.08
104 0.08
105 0.09