Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A2G4SIU5

Protein Details
Accession A0A2G4SIU5    Localization Confidence Medium Confidence Score 10.5
NoLS Segment(s)
PositionSequenceProtein Nature
3-29CEWENCPRKEKPFTKRHKMYNHLRTHTHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 20.5, cyto_nucl 11, mito 6
Family & Domain DBs
InterPro View protein in InterPro  
IPR036236  Znf_C2H2_sf  
IPR013087  Znf_C2H2_type  
Pfam View protein in Pfam  
PF00096  zf-C2H2  
PROSITE View protein in PROSITE  
PS00028  ZINC_FINGER_C2H2_1  
PS50157  ZINC_FINGER_C2H2_2  
Amino Acid Sequences YSCEWENCPRKEKPFTKRHKMYNHLRTHTGERPFVCTQDGCGKKFSRPDSLTTHIKTHSNVRPYTCYVKNCGKSYYHARSLRKHEKTH
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.72
2 0.77
3 0.81
4 0.84
5 0.85
6 0.85
7 0.85
8 0.85
9 0.85
10 0.84
11 0.77
12 0.72
13 0.66
14 0.63
15 0.6
16 0.53
17 0.47
18 0.38
19 0.41
20 0.38
21 0.35
22 0.3
23 0.23
24 0.21
25 0.27
26 0.29
27 0.23
28 0.27
29 0.27
30 0.28
31 0.33
32 0.34
33 0.33
34 0.32
35 0.35
36 0.37
37 0.42
38 0.45
39 0.41
40 0.41
41 0.34
42 0.34
43 0.32
44 0.34
45 0.34
46 0.35
47 0.35
48 0.36
49 0.39
50 0.41
51 0.47
52 0.45
53 0.41
54 0.41
55 0.49
56 0.52
57 0.51
58 0.5
59 0.45
60 0.45
61 0.53
62 0.55
63 0.55
64 0.56
65 0.59
66 0.64
67 0.73
68 0.77