Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A2G4T4U1

Protein Details
Accession A0A2G4T4U1    Localization Confidence Medium Confidence Score 13.7
NoLS Segment(s)
PositionSequenceProtein Nature
126-146IAALKCRQRKKQWLQNLQAKVHydrophilic
NLS Segment(s)
PositionSequence
94-103KKPAKRTRKG
Subcellular Location(s) nucl 22.5, cyto_nucl 13.5, cyto 3.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR004827  bZIP  
IPR046347  bZIP_sf  
IPR002112  Leuzip_Jun  
IPR020956  TF_Aft1_OSM  
Gene Ontology GO:0003677  F:DNA binding  
GO:0003700  F:DNA-binding transcription factor activity  
Pfam View protein in Pfam  
PF11785  Aft1_OSA  
PF00170  bZIP_1  
PROSITE View protein in PROSITE  
PS50217  BZIP  
CDD cd14687  bZIP_ATF2  
Amino Acid Sequences MIELTTSNTSTENTEEAVLPPTYAKLPTTKLEEEPNPFEQSFEGATKAAEIMPLPPERIIPDSMLDTTRNANNKQSATTFYNTFDNKSQSEESKKPAKRTRKGTIKEATTIEDEIKRKNFLERNRIAALKCRQRKKQWLQNLQAKVEYLTADNEQYHLQANALREELINLKTLLMAHKDCPINQQAIQNALNRPIPGLPSLGQPPYEYINNISIIQPPLPPHPK
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.15
2 0.15
3 0.15
4 0.18
5 0.16
6 0.14
7 0.14
8 0.14
9 0.14
10 0.15
11 0.15
12 0.15
13 0.19
14 0.23
15 0.29
16 0.31
17 0.32
18 0.38
19 0.42
20 0.44
21 0.45
22 0.45
23 0.42
24 0.39
25 0.37
26 0.3
27 0.27
28 0.23
29 0.19
30 0.16
31 0.12
32 0.12
33 0.12
34 0.12
35 0.1
36 0.08
37 0.07
38 0.07
39 0.12
40 0.13
41 0.13
42 0.13
43 0.14
44 0.15
45 0.17
46 0.17
47 0.13
48 0.14
49 0.14
50 0.15
51 0.16
52 0.15
53 0.14
54 0.15
55 0.18
56 0.21
57 0.21
58 0.24
59 0.28
60 0.28
61 0.29
62 0.28
63 0.29
64 0.28
65 0.29
66 0.26
67 0.23
68 0.28
69 0.26
70 0.27
71 0.25
72 0.24
73 0.22
74 0.24
75 0.25
76 0.23
77 0.29
78 0.3
79 0.32
80 0.39
81 0.42
82 0.47
83 0.53
84 0.6
85 0.61
86 0.67
87 0.72
88 0.72
89 0.73
90 0.73
91 0.71
92 0.63
93 0.58
94 0.5
95 0.42
96 0.32
97 0.29
98 0.22
99 0.2
100 0.18
101 0.18
102 0.19
103 0.18
104 0.17
105 0.23
106 0.27
107 0.29
108 0.38
109 0.38
110 0.42
111 0.43
112 0.44
113 0.38
114 0.41
115 0.43
116 0.43
117 0.48
118 0.5
119 0.56
120 0.62
121 0.73
122 0.75
123 0.77
124 0.78
125 0.8
126 0.81
127 0.82
128 0.78
129 0.69
130 0.59
131 0.5
132 0.4
133 0.31
134 0.22
135 0.15
136 0.12
137 0.11
138 0.12
139 0.11
140 0.12
141 0.11
142 0.11
143 0.11
144 0.1
145 0.09
146 0.11
147 0.12
148 0.13
149 0.13
150 0.13
151 0.11
152 0.12
153 0.15
154 0.13
155 0.13
156 0.12
157 0.11
158 0.12
159 0.12
160 0.13
161 0.15
162 0.16
163 0.15
164 0.22
165 0.24
166 0.23
167 0.28
168 0.29
169 0.28
170 0.29
171 0.32
172 0.28
173 0.32
174 0.34
175 0.33
176 0.32
177 0.33
178 0.32
179 0.28
180 0.27
181 0.23
182 0.22
183 0.18
184 0.19
185 0.16
186 0.18
187 0.22
188 0.23
189 0.22
190 0.21
191 0.23
192 0.24
193 0.25
194 0.22
195 0.21
196 0.23
197 0.24
198 0.24
199 0.23
200 0.23
201 0.23
202 0.23
203 0.23
204 0.22