Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A2G4SJI5

Protein Details
Accession A0A2G4SJI5    Localization Confidence Medium Confidence Score 10.1
NoLS Segment(s)
PositionSequenceProtein Nature
45-70EELMKQYSKNNHRRRRRNSNSSINSDHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 20, cyto_nucl 12.833, cyto 3.5, cyto_mito 3.166
Family & Domain DBs
InterPro View protein in InterPro  
IPR024368  Ecl1/2/3  
Pfam View protein in Pfam  
PF12855  Ecl1  
Amino Acid Sequences MCDTNWCTFCDCAVSPHLNTIYCSEECFRKDAQSHLYSTLIAHEEELMKQYSKNNHRRRRRNSNSSINSDDLAAIHLDLMSSSSSRPLLLSDSSSVASSQSIETPRLLHKITWNK
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.26
2 0.24
3 0.29
4 0.31
5 0.26
6 0.27
7 0.26
8 0.26
9 0.22
10 0.23
11 0.2
12 0.23
13 0.23
14 0.25
15 0.23
16 0.23
17 0.25
18 0.27
19 0.33
20 0.31
21 0.31
22 0.31
23 0.3
24 0.25
25 0.23
26 0.21
27 0.15
28 0.12
29 0.1
30 0.09
31 0.09
32 0.09
33 0.11
34 0.1
35 0.09
36 0.1
37 0.13
38 0.21
39 0.3
40 0.4
41 0.49
42 0.58
43 0.68
44 0.78
45 0.84
46 0.87
47 0.87
48 0.87
49 0.86
50 0.87
51 0.82
52 0.78
53 0.72
54 0.61
55 0.51
56 0.41
57 0.32
58 0.21
59 0.15
60 0.1
61 0.06
62 0.05
63 0.04
64 0.04
65 0.04
66 0.05
67 0.04
68 0.05
69 0.05
70 0.07
71 0.07
72 0.08
73 0.08
74 0.08
75 0.11
76 0.12
77 0.14
78 0.13
79 0.15
80 0.15
81 0.16
82 0.15
83 0.12
84 0.11
85 0.1
86 0.1
87 0.13
88 0.14
89 0.16
90 0.16
91 0.19
92 0.22
93 0.26
94 0.27
95 0.25