Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A2G4SEP9

Protein Details
Accession A0A2G4SEP9    Localization Confidence High Confidence Score 18
NoLS Segment(s)
PositionSequenceProtein Nature
129-153LSRLQKRTGKIIHRPSRNRRNRVWLHydrophilic
NLS Segment(s)
PositionSequence
133-149QKRTGKIIHRPSRNRRN
Subcellular Location(s) nucl 26
Family & Domain DBs
InterPro View protein in InterPro  
IPR036882  Alba-like_dom_sf  
IPR002775  DNA/RNA-bd_Alba-like  
IPR014612  Pop7/Rpp20  
Gene Ontology GO:0005655  C:nucleolar ribonuclease P complex  
GO:0000172  C:ribonuclease MRP complex  
GO:0003676  F:nucleic acid binding  
GO:0004526  F:ribonuclease P activity  
GO:0001682  P:tRNA 5'-leader removal  
Pfam View protein in Pfam  
PF01918  Alba  
Amino Acid Sequences MAETNYKKRSLIEGSIHKRKPQRPASVPADIYIASNSKSSAIVNRVKRLMLKENHNTVTIHGLGAMVTRAISIALRAQETLNNQIELKPTTETIALTDDIIPNDMEKDQSTQQRMNSAIRIKLEAKEGLSRLQKRTGKIIHRPSRNRRNRVWL
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.57
2 0.66
3 0.67
4 0.67
5 0.69
6 0.68
7 0.69
8 0.68
9 0.7
10 0.66
11 0.73
12 0.73
13 0.72
14 0.66
15 0.56
16 0.49
17 0.38
18 0.32
19 0.24
20 0.19
21 0.12
22 0.12
23 0.11
24 0.1
25 0.11
26 0.1
27 0.14
28 0.19
29 0.25
30 0.3
31 0.34
32 0.35
33 0.35
34 0.37
35 0.37
36 0.4
37 0.38
38 0.42
39 0.44
40 0.49
41 0.5
42 0.49
43 0.44
44 0.35
45 0.33
46 0.25
47 0.17
48 0.11
49 0.09
50 0.08
51 0.08
52 0.07
53 0.04
54 0.03
55 0.03
56 0.03
57 0.03
58 0.03
59 0.03
60 0.05
61 0.06
62 0.06
63 0.07
64 0.07
65 0.09
66 0.11
67 0.16
68 0.15
69 0.14
70 0.14
71 0.15
72 0.17
73 0.16
74 0.16
75 0.11
76 0.11
77 0.11
78 0.11
79 0.1
80 0.09
81 0.1
82 0.09
83 0.09
84 0.1
85 0.1
86 0.09
87 0.1
88 0.09
89 0.07
90 0.08
91 0.08
92 0.08
93 0.08
94 0.11
95 0.15
96 0.21
97 0.25
98 0.27
99 0.28
100 0.32
101 0.34
102 0.33
103 0.34
104 0.33
105 0.32
106 0.3
107 0.33
108 0.31
109 0.3
110 0.31
111 0.28
112 0.26
113 0.27
114 0.27
115 0.3
116 0.37
117 0.4
118 0.4
119 0.47
120 0.49
121 0.47
122 0.55
123 0.56
124 0.57
125 0.62
126 0.7
127 0.7
128 0.76
129 0.84
130 0.86
131 0.89
132 0.9
133 0.88