Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A2G4T7E4

Protein Details
Accession A0A2G4T7E4    Localization Confidence Low Confidence Score 8
NoLS Segment(s)
PositionSequenceProtein Nature
74-99NLLRKRQPLRRLGRIFNRIRKPRKHYBasic
NLS Segment(s)
PositionSequence
77-98RKRQPLRRLGRIFNRIRKPRKH
Subcellular Location(s) extr 24, mito 1, E.R. 1, vacu 1
Family & Domain DBs
Amino Acid Sequences MQIKLVTLTICASLVAIGFAAPAPQDGQSSFDSPFSDEVAPFVSVGSGPNPPAVGGIDEGAEPAFSDGFDIGENLLRKRQPLRRLGRIFNRIRKPRKHY
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.07
2 0.06
3 0.05
4 0.04
5 0.04
6 0.04
7 0.04
8 0.04
9 0.04
10 0.05
11 0.06
12 0.07
13 0.07
14 0.11
15 0.12
16 0.14
17 0.14
18 0.14
19 0.14
20 0.15
21 0.15
22 0.14
23 0.13
24 0.11
25 0.11
26 0.11
27 0.11
28 0.1
29 0.09
30 0.06
31 0.06
32 0.06
33 0.07
34 0.06
35 0.06
36 0.06
37 0.06
38 0.06
39 0.07
40 0.06
41 0.06
42 0.05
43 0.05
44 0.05
45 0.05
46 0.05
47 0.05
48 0.04
49 0.04
50 0.04
51 0.04
52 0.03
53 0.04
54 0.04
55 0.04
56 0.04
57 0.05
58 0.05
59 0.09
60 0.11
61 0.11
62 0.16
63 0.16
64 0.19
65 0.27
66 0.35
67 0.39
68 0.48
69 0.57
70 0.63
71 0.7
72 0.76
73 0.78
74 0.81
75 0.81
76 0.81
77 0.83
78 0.83
79 0.85