Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A2G4SNV0

Protein Details
Accession A0A2G4SNV0    Localization Confidence Low Confidence Score 7
NoLS Segment(s)
PositionSequenceProtein Nature
16-37GQYYHETRSHRRYKKGIRRLGSBasic
NLS Segment(s)
Subcellular Location(s) cyto_nucl 10.999, nucl 10.5, cyto 9, mito_nucl 8.832, cyto_mito 8.499, mito 5.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR000095  CRIB_dom  
IPR036936  CRIB_dom_sf  
Pfam View protein in Pfam  
PF00786  PBD  
PROSITE View protein in PROSITE  
PS50108  CRIB  
Amino Acid Sequences MGNTNSTSSIYSAPNGQYYHETRSHRRYKKGIRRLGSGMTLSKLYSHPNMSTPNMPSKATAWKNQFGEKILDISKPTKFEHGIHVEYDDGSGKFMVFHPKTTISHNLTLFLIGFT
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.23
2 0.22
3 0.22
4 0.25
5 0.27
6 0.32
7 0.34
8 0.38
9 0.41
10 0.51
11 0.6
12 0.61
13 0.66
14 0.7
15 0.75
16 0.8
17 0.84
18 0.82
19 0.76
20 0.74
21 0.7
22 0.62
23 0.54
24 0.45
25 0.35
26 0.28
27 0.24
28 0.18
29 0.16
30 0.14
31 0.14
32 0.14
33 0.15
34 0.15
35 0.17
36 0.2
37 0.21
38 0.23
39 0.22
40 0.26
41 0.25
42 0.25
43 0.22
44 0.21
45 0.28
46 0.28
47 0.32
48 0.3
49 0.34
50 0.36
51 0.38
52 0.38
53 0.31
54 0.31
55 0.25
56 0.23
57 0.19
58 0.18
59 0.17
60 0.18
61 0.19
62 0.19
63 0.2
64 0.21
65 0.22
66 0.22
67 0.28
68 0.32
69 0.31
70 0.29
71 0.29
72 0.25
73 0.23
74 0.22
75 0.16
76 0.11
77 0.1
78 0.1
79 0.08
80 0.09
81 0.11
82 0.21
83 0.19
84 0.22
85 0.25
86 0.3
87 0.31
88 0.36
89 0.42
90 0.37
91 0.43
92 0.41
93 0.39
94 0.35
95 0.34