Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

J0WKG8

Protein Details
Accession J0WKG8   
Localization Confidence Low
Confidence Score 8.3
NoLS Segment(s)
PositionSequenceProtein Nature
50-76TFSRSARLSNQKRTHSRRSWKLKSVACHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 9, cyto 7, mito 6, extr 5
Family & Domain DBs
KEGG adl:AURDEDRAFT_178701  -  
Amino Acid Sequences MCLLVPPGTGSPLAEGQVQPLRHLPAVWRVPAYEPGSLAPALISGRATATFSRSARLSNQKRTHSRRSWKLKSVACSPVHAAESESMSEKRTQRPRPASIRRLDRDRPLQDLLIPGCDVRIGTKLSPASFNARSVARRRARHIPVPGSSNSLLAHRQRAVRVSGLGLRSAKDKCNAGIAVDRDGSRLFAGFTLTTRGEAGLAAGRTLRCKERCPYKTTRPDALVARRRTPGVDECTQTSSF
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.16
2 0.15
3 0.18
4 0.23
5 0.23
6 0.22
7 0.24
8 0.26
9 0.24
10 0.25
11 0.23
12 0.27
13 0.32
14 0.33
15 0.3
16 0.28
17 0.3
18 0.37
19 0.37
20 0.28
21 0.24
22 0.22
23 0.23
24 0.22
25 0.19
26 0.12
27 0.1
28 0.09
29 0.09
30 0.08
31 0.06
32 0.07
33 0.08
34 0.1
35 0.09
36 0.12
37 0.17
38 0.18
39 0.2
40 0.2
41 0.21
42 0.27
43 0.37
44 0.42
45 0.47
46 0.55
47 0.61
48 0.71
49 0.77
50 0.8
51 0.79
52 0.81
53 0.81
54 0.84
55 0.83
56 0.82
57 0.82
58 0.76
59 0.72
60 0.68
61 0.66
62 0.56
63 0.5
64 0.43
65 0.37
66 0.33
67 0.28
68 0.22
69 0.15
70 0.15
71 0.13
72 0.14
73 0.12
74 0.12
75 0.17
76 0.19
77 0.27
78 0.35
79 0.41
80 0.48
81 0.55
82 0.62
83 0.67
84 0.74
85 0.73
86 0.72
87 0.75
88 0.69
89 0.69
90 0.65
91 0.61
92 0.6
93 0.54
94 0.5
95 0.42
96 0.38
97 0.32
98 0.31
99 0.25
100 0.17
101 0.15
102 0.1
103 0.09
104 0.08
105 0.07
106 0.05
107 0.07
108 0.08
109 0.08
110 0.11
111 0.12
112 0.13
113 0.14
114 0.14
115 0.18
116 0.18
117 0.18
118 0.17
119 0.18
120 0.21
121 0.23
122 0.32
123 0.34
124 0.36
125 0.4
126 0.48
127 0.52
128 0.55
129 0.58
130 0.53
131 0.49
132 0.49
133 0.45
134 0.4
135 0.35
136 0.29
137 0.23
138 0.19
139 0.2
140 0.18
141 0.21
142 0.19
143 0.21
144 0.22
145 0.24
146 0.25
147 0.22
148 0.21
149 0.2
150 0.2
151 0.19
152 0.2
153 0.18
154 0.17
155 0.19
156 0.2
157 0.21
158 0.21
159 0.22
160 0.2
161 0.24
162 0.24
163 0.22
164 0.25
165 0.24
166 0.24
167 0.24
168 0.23
169 0.19
170 0.19
171 0.18
172 0.13
173 0.12
174 0.09
175 0.08
176 0.09
177 0.09
178 0.09
179 0.13
180 0.13
181 0.13
182 0.13
183 0.13
184 0.11
185 0.1
186 0.11
187 0.11
188 0.11
189 0.1
190 0.12
191 0.13
192 0.16
193 0.2
194 0.27
195 0.26
196 0.31
197 0.4
198 0.49
199 0.54
200 0.59
201 0.65
202 0.67
203 0.75
204 0.76
205 0.76
206 0.68
207 0.67
208 0.68
209 0.69
210 0.68
211 0.63
212 0.62
213 0.57
214 0.55
215 0.51
216 0.48
217 0.46
218 0.44
219 0.44
220 0.42
221 0.42