Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A2G4SU94

Protein Details
Accession A0A2G4SU94    Localization Confidence High Confidence Score 18.4
NoLS Segment(s)
PositionSequenceProtein Nature
2-28ITLLKKGKGYFKKKNLTGKTPNLPKQSHydrophilic
200-226LIKKYKGWSKEAKKRRHTRLPEHKALYBasic
301-320ASNRTKKKQAIEEHIIKKRYHydrophilic
NLS Segment(s)
PositionSequence
198-221RKLIKKYKGWSKEAKKRRHTRLPE
Subcellular Location(s) nucl 20.5, cyto_nucl 12.5, mito 5
Family & Domain DBs
Amino Acid Sequences MITLLKKGKGYFKKKNLTGKTPNLPKQSASSETCSTYDTPPSSPEAYSKPHTPSSSSEACSVPPTSPTSPKIYSKPHTPSSSSVPHTSSTSPETYSKPHTPSSSETHSAELETRLSPEEVNNATQARNTDVPDAPSSISETHSAPVTPSSSSETRTLDTSPESPHARKENQNDNLPRQLDPNRSISGLEPLEIEEVSRKLIKKYKGWSKEAKKRRHTRLPEHKALYERKLNRYIIQLRDEELRRENVPVNRETVVANLDTFVVFLERLNTLNERTAANISKLFYELFNGENNVLFGEAMFASNRTKKKQAIEEHIIKKRYEESNPPK
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.79
2 0.87
3 0.85
4 0.85
5 0.84
6 0.83
7 0.83
8 0.83
9 0.83
10 0.8
11 0.73
12 0.65
13 0.6
14 0.57
15 0.53
16 0.47
17 0.44
18 0.4
19 0.41
20 0.4
21 0.36
22 0.33
23 0.29
24 0.31
25 0.27
26 0.25
27 0.25
28 0.29
29 0.28
30 0.27
31 0.28
32 0.26
33 0.29
34 0.33
35 0.36
36 0.36
37 0.4
38 0.41
39 0.4
40 0.4
41 0.42
42 0.43
43 0.4
44 0.38
45 0.33
46 0.32
47 0.32
48 0.28
49 0.22
50 0.19
51 0.22
52 0.23
53 0.28
54 0.3
55 0.34
56 0.37
57 0.42
58 0.46
59 0.49
60 0.5
61 0.53
62 0.57
63 0.58
64 0.58
65 0.56
66 0.53
67 0.51
68 0.54
69 0.48
70 0.44
71 0.38
72 0.35
73 0.34
74 0.32
75 0.28
76 0.24
77 0.22
78 0.21
79 0.23
80 0.23
81 0.25
82 0.31
83 0.33
84 0.33
85 0.35
86 0.34
87 0.35
88 0.37
89 0.4
90 0.39
91 0.37
92 0.34
93 0.32
94 0.31
95 0.28
96 0.25
97 0.2
98 0.15
99 0.12
100 0.12
101 0.11
102 0.11
103 0.11
104 0.1
105 0.14
106 0.14
107 0.14
108 0.15
109 0.15
110 0.14
111 0.15
112 0.16
113 0.14
114 0.15
115 0.15
116 0.17
117 0.17
118 0.19
119 0.19
120 0.19
121 0.16
122 0.14
123 0.15
124 0.12
125 0.12
126 0.11
127 0.11
128 0.1
129 0.11
130 0.1
131 0.09
132 0.1
133 0.09
134 0.08
135 0.08
136 0.12
137 0.12
138 0.15
139 0.17
140 0.17
141 0.16
142 0.17
143 0.17
144 0.14
145 0.15
146 0.14
147 0.13
148 0.16
149 0.18
150 0.18
151 0.22
152 0.26
153 0.28
154 0.32
155 0.38
156 0.43
157 0.46
158 0.53
159 0.53
160 0.51
161 0.53
162 0.48
163 0.41
164 0.36
165 0.35
166 0.32
167 0.31
168 0.32
169 0.27
170 0.26
171 0.26
172 0.23
173 0.23
174 0.18
175 0.16
176 0.12
177 0.11
178 0.12
179 0.11
180 0.1
181 0.07
182 0.07
183 0.08
184 0.11
185 0.11
186 0.15
187 0.22
188 0.26
189 0.31
190 0.4
191 0.48
192 0.54
193 0.59
194 0.65
195 0.69
196 0.75
197 0.78
198 0.79
199 0.8
200 0.82
201 0.86
202 0.86
203 0.85
204 0.86
205 0.88
206 0.87
207 0.86
208 0.79
209 0.73
210 0.69
211 0.64
212 0.59
213 0.57
214 0.53
215 0.5
216 0.53
217 0.51
218 0.47
219 0.51
220 0.52
221 0.48
222 0.47
223 0.41
224 0.36
225 0.42
226 0.41
227 0.36
228 0.32
229 0.3
230 0.27
231 0.29
232 0.33
233 0.3
234 0.33
235 0.31
236 0.31
237 0.28
238 0.28
239 0.26
240 0.21
241 0.18
242 0.14
243 0.13
244 0.1
245 0.1
246 0.09
247 0.08
248 0.07
249 0.06
250 0.05
251 0.06
252 0.07
253 0.08
254 0.09
255 0.11
256 0.13
257 0.14
258 0.18
259 0.19
260 0.18
261 0.19
262 0.23
263 0.23
264 0.23
265 0.24
266 0.21
267 0.21
268 0.22
269 0.2
270 0.16
271 0.17
272 0.15
273 0.14
274 0.16
275 0.16
276 0.16
277 0.16
278 0.16
279 0.13
280 0.12
281 0.1
282 0.08
283 0.08
284 0.08
285 0.08
286 0.08
287 0.09
288 0.14
289 0.22
290 0.27
291 0.31
292 0.38
293 0.42
294 0.51
295 0.59
296 0.64
297 0.67
298 0.71
299 0.76
300 0.79
301 0.81
302 0.76
303 0.67
304 0.6
305 0.58
306 0.55
307 0.52