Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A2G4SP47

Protein Details
Accession A0A2G4SP47    Localization Confidence Medium Confidence Score 13.8
NoLS Segment(s)
PositionSequenceProtein Nature
32-61QTPKVAKQEKKKPKTGRAKKRQIYNRRFVNHydrophilic
NLS Segment(s)
PositionSequence
25-53RAGKVKSQTPKVAKQEKKKPKTGRAKKRQ
Subcellular Location(s) nucl 15, mito 7, cyto 4
Family & Domain DBs
InterPro View protein in InterPro  
IPR006846  Ribosomal_S30  
Gene Ontology GO:1990904  C:ribonucleoprotein complex  
GO:0005840  C:ribosome  
GO:0003735  F:structural constituent of ribosome  
GO:0006412  P:translation  
Pfam View protein in Pfam  
PF04758  Ribosomal_S30  
Amino Acid Sequences MLNLYKKMTNLHKSNMGKVHGSLARAGKVKSQTPKVAKQEKKKPKTGRAKKRQIYNRRFVNVTTQIGGKRRMNPAPTQGP
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.59
2 0.58
3 0.52
4 0.44
5 0.39
6 0.41
7 0.33
8 0.31
9 0.28
10 0.25
11 0.26
12 0.26
13 0.26
14 0.24
15 0.26
16 0.3
17 0.33
18 0.36
19 0.4
20 0.43
21 0.5
22 0.55
23 0.61
24 0.63
25 0.66
26 0.72
27 0.75
28 0.76
29 0.77
30 0.77
31 0.77
32 0.81
33 0.83
34 0.83
35 0.84
36 0.88
37 0.84
38 0.86
39 0.86
40 0.86
41 0.84
42 0.82
43 0.8
44 0.73
45 0.69
46 0.59
47 0.58
48 0.54
49 0.47
50 0.39
51 0.33
52 0.33
53 0.36
54 0.42
55 0.38
56 0.38
57 0.43
58 0.48
59 0.49
60 0.51