Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A2G4T1M6

Protein Details
Accession A0A2G4T1M6    Localization Confidence Low Confidence Score 7.7
NoLS Segment(s)
PositionSequenceProtein Nature
259-279LSKVIGKRDTRRHIRNIEVREHydrophilic
NLS Segment(s)
Subcellular Location(s) mito 17, nucl 8.5, cyto_nucl 5.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR020103  PsdUridine_synth_cat_dom_sf  
IPR001406  PsdUridine_synth_TruA  
IPR020095  PsdUridine_synth_TruA_C  
IPR020094  TruA/RsuA/RluB/E/F_N  
Gene Ontology GO:0009982  F:pseudouridine synthase activity  
GO:0003723  F:RNA binding  
GO:0001522  P:pseudouridine synthesis  
Amino Acid Sequences MPCTFYRSNRCLSTFSTIRSLLGNFLQSKNKQLPKVNLQDTTIRKPKKKVAVMVGFNGSKYYGMQFQDNVVSIERTLFEAFCKIDAISKQNSLHPSKVQFHRAARTDKGVHAACNVVSLKIIPDPCFIEKANSVLPSDIRLWGMYEHIHALPVFISSLGYVETTKGFNAKNQCDSRIYEYLLPTYALREKQTNIVLKEQPGAPTDIMVRMGDNHGDERYVTMTNPSILSNYRVNQERLDKFSEAMSMFKGTHDFHNYTLSKVIGKRDTRRHIRNIEVREVAHVEAQFKVNST
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.46
2 0.44
3 0.43
4 0.38
5 0.36
6 0.35
7 0.31
8 0.25
9 0.24
10 0.26
11 0.23
12 0.27
13 0.34
14 0.33
15 0.39
16 0.46
17 0.5
18 0.52
19 0.57
20 0.61
21 0.63
22 0.72
23 0.7
24 0.64
25 0.59
26 0.61
27 0.59
28 0.59
29 0.59
30 0.56
31 0.57
32 0.6
33 0.67
34 0.69
35 0.7
36 0.68
37 0.7
38 0.71
39 0.69
40 0.66
41 0.63
42 0.53
43 0.45
44 0.38
45 0.28
46 0.19
47 0.16
48 0.14
49 0.14
50 0.15
51 0.17
52 0.17
53 0.18
54 0.2
55 0.2
56 0.19
57 0.15
58 0.14
59 0.12
60 0.13
61 0.11
62 0.11
63 0.11
64 0.1
65 0.09
66 0.12
67 0.12
68 0.11
69 0.12
70 0.1
71 0.13
72 0.15
73 0.19
74 0.19
75 0.23
76 0.24
77 0.27
78 0.33
79 0.33
80 0.33
81 0.33
82 0.36
83 0.39
84 0.43
85 0.45
86 0.45
87 0.45
88 0.49
89 0.51
90 0.5
91 0.44
92 0.45
93 0.41
94 0.36
95 0.39
96 0.32
97 0.27
98 0.24
99 0.22
100 0.16
101 0.18
102 0.17
103 0.11
104 0.1
105 0.1
106 0.09
107 0.11
108 0.13
109 0.1
110 0.12
111 0.14
112 0.15
113 0.17
114 0.17
115 0.16
116 0.15
117 0.16
118 0.16
119 0.15
120 0.14
121 0.13
122 0.13
123 0.13
124 0.13
125 0.12
126 0.1
127 0.09
128 0.09
129 0.09
130 0.1
131 0.08
132 0.07
133 0.08
134 0.08
135 0.08
136 0.07
137 0.07
138 0.06
139 0.06
140 0.06
141 0.04
142 0.04
143 0.03
144 0.04
145 0.04
146 0.04
147 0.04
148 0.05
149 0.06
150 0.06
151 0.06
152 0.09
153 0.09
154 0.12
155 0.19
156 0.22
157 0.29
158 0.31
159 0.33
160 0.33
161 0.35
162 0.37
163 0.32
164 0.31
165 0.25
166 0.24
167 0.23
168 0.21
169 0.2
170 0.14
171 0.13
172 0.16
173 0.15
174 0.16
175 0.17
176 0.18
177 0.22
178 0.28
179 0.31
180 0.29
181 0.33
182 0.34
183 0.33
184 0.34
185 0.31
186 0.27
187 0.22
188 0.23
189 0.16
190 0.15
191 0.15
192 0.14
193 0.13
194 0.12
195 0.1
196 0.09
197 0.11
198 0.11
199 0.11
200 0.11
201 0.11
202 0.11
203 0.11
204 0.11
205 0.12
206 0.11
207 0.1
208 0.11
209 0.12
210 0.13
211 0.14
212 0.13
213 0.13
214 0.13
215 0.17
216 0.19
217 0.2
218 0.24
219 0.28
220 0.29
221 0.33
222 0.4
223 0.41
224 0.41
225 0.44
226 0.39
227 0.35
228 0.35
229 0.34
230 0.26
231 0.22
232 0.19
233 0.16
234 0.16
235 0.16
236 0.18
237 0.16
238 0.21
239 0.27
240 0.26
241 0.26
242 0.35
243 0.35
244 0.33
245 0.34
246 0.29
247 0.28
248 0.29
249 0.35
250 0.35
251 0.42
252 0.49
253 0.57
254 0.67
255 0.72
256 0.78
257 0.8
258 0.79
259 0.81
260 0.81
261 0.77
262 0.74
263 0.68
264 0.6
265 0.55
266 0.49
267 0.4
268 0.35
269 0.3
270 0.24
271 0.22
272 0.24