Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A2G4SIE4

Protein Details
Accession A0A2G4SIE4    Localization Confidence Medium Confidence Score 14.3
NoLS Segment(s)
PositionSequenceProtein Nature
68-92GSRGNIQKGRGKKKNKNDLKGGDIFHydrophilic
NLS Segment(s)
PositionSequence
41-84SAAEKKELEIKNKVARSLKSQANGSNRGSRGNIQKGRGKKKNKN
Subcellular Location(s) nucl 24.5, cyto_nucl 14.5
Family & Domain DBs
Amino Acid Sequences MDEEARLKERSEKIERLNNRDYKAYRDNSTKKPSTTEKKLSAAEKKELEIKNKVARSLKSQANGSNRGSRGNIQKGRGKKKNKNDLKGGDIF
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.59
2 0.65
3 0.64
4 0.68
5 0.65
6 0.6
7 0.61
8 0.55
9 0.53
10 0.55
11 0.51
12 0.47
13 0.51
14 0.55
15 0.57
16 0.64
17 0.6
18 0.53
19 0.54
20 0.58
21 0.57
22 0.59
23 0.58
24 0.54
25 0.55
26 0.57
27 0.57
28 0.55
29 0.49
30 0.45
31 0.38
32 0.34
33 0.37
34 0.36
35 0.35
36 0.32
37 0.33
38 0.35
39 0.35
40 0.38
41 0.35
42 0.34
43 0.37
44 0.4
45 0.39
46 0.36
47 0.38
48 0.4
49 0.42
50 0.45
51 0.42
52 0.42
53 0.38
54 0.37
55 0.37
56 0.36
57 0.39
58 0.44
59 0.46
60 0.44
61 0.51
62 0.58
63 0.67
64 0.71
65 0.73
66 0.73
67 0.79
68 0.85
69 0.88
70 0.87
71 0.87
72 0.84