Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A2G4SS61

Protein Details
Accession A0A2G4SS61    Localization Confidence Low Confidence Score 8
NoLS Segment(s)
PositionSequenceProtein Nature
34-59SIKLYYKKGKSIKKQNKTKVNQVGRCHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 10, mito 9.5, cyto_mito 7, cyto 3.5, pero 3
Family & Domain DBs
Amino Acid Sequences MSAANEYCFGVTTYLSPEAIRNIINLLCHYLPSSIKLYYKKGKSIKKQNKTKVNQVGRCFSMLDHPEMLLLLWLCLYS
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.13
2 0.14
3 0.13
4 0.13
5 0.15
6 0.16
7 0.15
8 0.11
9 0.12
10 0.12
11 0.13
12 0.12
13 0.13
14 0.12
15 0.12
16 0.12
17 0.12
18 0.12
19 0.14
20 0.15
21 0.13
22 0.17
23 0.2
24 0.24
25 0.3
26 0.32
27 0.37
28 0.43
29 0.49
30 0.56
31 0.64
32 0.7
33 0.73
34 0.81
35 0.83
36 0.86
37 0.83
38 0.83
39 0.82
40 0.81
41 0.78
42 0.72
43 0.68
44 0.59
45 0.55
46 0.45
47 0.35
48 0.33
49 0.29
50 0.27
51 0.23
52 0.21
53 0.2
54 0.2
55 0.19
56 0.13
57 0.11
58 0.08