Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

J0WJL4

Protein Details
Accession J0WJL4   
Localization Confidence Medium
Confidence Score 11.7
NoLS Segment(s)
PositionSequenceProtein Nature
203-228CRVWTRRSGAGPRRVRRKRGGGQEASHydrophilic
NLS Segment(s)
PositionSequence
209-222RSGAGPRRVRRKRG
Subcellular Location(s) nucl 12.5, cyto_nucl 10, cyto 6.5, extr 3, mito 2
Family & Domain DBs
KEGG adl:AURDEDRAFT_118050  -  
Amino Acid Sequences MPGLTAVDLELHSALIASAFLPQEAAFAGAARDSVWYKAVIPDAIPPDPSQPLPSSQVLQAEVEDYVQHRFSWAAPPIWLTPASRVAEQGSGSVLLSFSRQEDLKYVLRNGVFLFGRALRVRRFRDSGRPRPCSNCCSLEHSARACSQAPRCGLCSGGHLTSEHRCGECDFFDNAHEGLAHCGHTPLCCPHCAGSHAMCDSACRVWTRRSGAGPRRVRRKRGGGQEASAMDLS
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.07
2 0.05
3 0.05
4 0.04
5 0.07
6 0.07
7 0.07
8 0.08
9 0.08
10 0.08
11 0.08
12 0.09
13 0.06
14 0.06
15 0.07
16 0.06
17 0.06
18 0.06
19 0.08
20 0.08
21 0.09
22 0.1
23 0.11
24 0.12
25 0.14
26 0.16
27 0.15
28 0.14
29 0.18
30 0.21
31 0.21
32 0.21
33 0.19
34 0.2
35 0.22
36 0.22
37 0.2
38 0.17
39 0.19
40 0.23
41 0.24
42 0.23
43 0.22
44 0.24
45 0.22
46 0.21
47 0.18
48 0.14
49 0.12
50 0.11
51 0.09
52 0.08
53 0.09
54 0.09
55 0.09
56 0.09
57 0.09
58 0.1
59 0.16
60 0.18
61 0.18
62 0.17
63 0.2
64 0.2
65 0.21
66 0.21
67 0.15
68 0.14
69 0.19
70 0.2
71 0.18
72 0.18
73 0.18
74 0.18
75 0.18
76 0.15
77 0.1
78 0.09
79 0.08
80 0.08
81 0.06
82 0.05
83 0.05
84 0.05
85 0.05
86 0.07
87 0.07
88 0.07
89 0.09
90 0.13
91 0.16
92 0.17
93 0.17
94 0.19
95 0.18
96 0.18
97 0.17
98 0.17
99 0.13
100 0.12
101 0.13
102 0.1
103 0.13
104 0.13
105 0.15
106 0.15
107 0.22
108 0.25
109 0.28
110 0.32
111 0.32
112 0.42
113 0.5
114 0.56
115 0.59
116 0.61
117 0.59
118 0.62
119 0.64
120 0.57
121 0.52
122 0.46
123 0.39
124 0.41
125 0.42
126 0.38
127 0.38
128 0.35
129 0.32
130 0.29
131 0.29
132 0.24
133 0.25
134 0.24
135 0.26
136 0.27
137 0.26
138 0.28
139 0.26
140 0.25
141 0.21
142 0.22
143 0.19
144 0.18
145 0.17
146 0.15
147 0.17
148 0.19
149 0.22
150 0.2
151 0.17
152 0.17
153 0.18
154 0.2
155 0.19
156 0.19
157 0.17
158 0.16
159 0.17
160 0.18
161 0.16
162 0.14
163 0.13
164 0.1
165 0.11
166 0.11
167 0.11
168 0.09
169 0.11
170 0.11
171 0.11
172 0.14
173 0.18
174 0.2
175 0.2
176 0.21
177 0.22
178 0.26
179 0.27
180 0.28
181 0.24
182 0.27
183 0.27
184 0.27
185 0.24
186 0.22
187 0.22
188 0.2
189 0.19
190 0.17
191 0.2
192 0.24
193 0.31
194 0.36
195 0.4
196 0.45
197 0.53
198 0.6
199 0.67
200 0.72
201 0.74
202 0.79
203 0.82
204 0.83
205 0.82
206 0.84
207 0.83
208 0.84
209 0.85
210 0.8
211 0.74
212 0.73
213 0.63