Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A2G4T3U6

Protein Details
Accession A0A2G4T3U6    Localization Confidence Low Confidence Score 8
NoLS Segment(s)
PositionSequenceProtein Nature
78-105RTAKGHRKSFHKVPKFTKKTNRTSPPGFHydrophilic
NLS Segment(s)
PositionSequence
83-92HRKSFHKVPK
Subcellular Location(s) mito 23.5, cyto_mito 13
Family & Domain DBs
InterPro View protein in InterPro  
IPR016340  Ribosomal_L31_mit  
Gene Ontology GO:0005840  C:ribosome  
Pfam View protein in Pfam  
PF09784  L31  
Amino Acid Sequences MFGAFRPSLVAQSGLLWKNPFRMSATRKANVRKRLKDVDQVISTVAQSGVECKALTEALALPKESEMLPREKYTVFSRTAKGHRKSFHKVPKFTKKTNRTSPPGF
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.2
2 0.22
3 0.22
4 0.22
5 0.27
6 0.28
7 0.26
8 0.24
9 0.31
10 0.35
11 0.43
12 0.5
13 0.49
14 0.54
15 0.62
16 0.66
17 0.68
18 0.72
19 0.69
20 0.69
21 0.72
22 0.7
23 0.69
24 0.65
25 0.61
26 0.52
27 0.46
28 0.38
29 0.3
30 0.26
31 0.18
32 0.13
33 0.06
34 0.05
35 0.06
36 0.06
37 0.07
38 0.06
39 0.06
40 0.06
41 0.06
42 0.06
43 0.06
44 0.06
45 0.08
46 0.09
47 0.09
48 0.09
49 0.09
50 0.1
51 0.09
52 0.12
53 0.11
54 0.15
55 0.17
56 0.18
57 0.2
58 0.2
59 0.23
60 0.24
61 0.26
62 0.26
63 0.28
64 0.3
65 0.35
66 0.44
67 0.5
68 0.53
69 0.56
70 0.59
71 0.63
72 0.69
73 0.72
74 0.74
75 0.74
76 0.76
77 0.79
78 0.83
79 0.84
80 0.85
81 0.86
82 0.85
83 0.85
84 0.87
85 0.86