Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A2G4SG09

Protein Details
Accession A0A2G4SG09    Localization Confidence Low Confidence Score 9.9
NoLS Segment(s)
PositionSequenceProtein Nature
91-123LTSVLRKRRLKMNKHKHKKLRKRTRALRKRLGKBasic
NLS Segment(s)
PositionSequence
96-123RKRRLKMNKHKHKKLRKRTRALRKRLGK
Subcellular Location(s) mito 22, nucl 5
Family & Domain DBs
InterPro View protein in InterPro  
IPR013177  COX24_C  
Pfam View protein in Pfam  
PF08213  COX24_C  
Amino Acid Sequences MLSRVLSGHSFLHIVRRAIIPTWAGNTQRAVSTLPTVHNAQSIQLLGHNVKETKAAASISDYVSRLRPFSAPPAPQPITTPLTGVEEQLELTSVLRKRRLKMNKHKHKKLRKRTRALRKRLGK
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.24
2 0.24
3 0.25
4 0.25
5 0.25
6 0.27
7 0.21
8 0.18
9 0.21
10 0.22
11 0.22
12 0.22
13 0.23
14 0.22
15 0.2
16 0.2
17 0.18
18 0.15
19 0.17
20 0.17
21 0.16
22 0.18
23 0.19
24 0.18
25 0.19
26 0.18
27 0.15
28 0.14
29 0.13
30 0.1
31 0.1
32 0.11
33 0.1
34 0.11
35 0.12
36 0.11
37 0.11
38 0.12
39 0.11
40 0.1
41 0.11
42 0.1
43 0.08
44 0.1
45 0.11
46 0.11
47 0.12
48 0.12
49 0.11
50 0.13
51 0.13
52 0.12
53 0.12
54 0.12
55 0.11
56 0.17
57 0.23
58 0.22
59 0.24
60 0.31
61 0.32
62 0.31
63 0.32
64 0.3
65 0.26
66 0.25
67 0.23
68 0.16
69 0.19
70 0.19
71 0.17
72 0.13
73 0.11
74 0.11
75 0.1
76 0.1
77 0.06
78 0.06
79 0.12
80 0.14
81 0.19
82 0.27
83 0.31
84 0.34
85 0.45
86 0.54
87 0.6
88 0.68
89 0.75
90 0.79
91 0.86
92 0.93
93 0.93
94 0.95
95 0.95
96 0.95
97 0.95
98 0.95
99 0.95
100 0.95
101 0.96
102 0.95
103 0.95