Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A2G4SHK0

Protein Details
Accession A0A2G4SHK0   
Localization Confidence Low
Confidence Score 8
NoLS Segment(s)
PositionSequenceProtein Nature
15-37THTLCRRCGNRAFHKQKKTCAQCHydrophilic
NLS Segment(s)
PositionSequence
52-60KGKRRKTTG
Subcellular Location(s) mito 11, cyto 9, mito_nucl 9
Family & Domain DBs
InterPro View protein in InterPro  
IPR011331  Ribosomal_L37ae/L37e  
IPR001569  Ribosomal_L37e  
IPR018267  Ribosomal_L37e_CS  
IPR011332  Ribosomal_zn-bd  
Gene Ontology GO:1990904  C:ribonucleoprotein complex  
GO:0005840  C:ribosome  
GO:0046872  F:metal ion binding  
GO:0019843  F:rRNA binding  
GO:0003735  F:structural constituent of ribosome  
GO:0006412  P:translation  
Pfam View protein in Pfam  
PF01907  Ribosomal_L37e  
PROSITE View protein in PROSITE  
PS01077  RIBOSOMAL_L37E  
Amino Acid Sequences MTKGTSSFGKRHTKTHTLCRRCGNRAFHKQKKTCAQCGYPSAKIRSFNWSEKGKRRKTTGTGRMSHLKEVHRRFKNGFREGTQAKKQTAAATA
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.62
2 0.68
3 0.71
4 0.67
5 0.71
6 0.74
7 0.73
8 0.7
9 0.72
10 0.7
11 0.7
12 0.74
13 0.79
14 0.78
15 0.81
16 0.79
17 0.8
18 0.81
19 0.77
20 0.73
21 0.68
22 0.63
23 0.57
24 0.59
25 0.55
26 0.5
27 0.48
28 0.44
29 0.41
30 0.4
31 0.36
32 0.36
33 0.35
34 0.33
35 0.35
36 0.39
37 0.41
38 0.49
39 0.58
40 0.58
41 0.59
42 0.61
43 0.61
44 0.62
45 0.67
46 0.68
47 0.66
48 0.62
49 0.62
50 0.65
51 0.6
52 0.56
53 0.5
54 0.46
55 0.47
56 0.52
57 0.58
58 0.56
59 0.59
60 0.59
61 0.64
62 0.68
63 0.66
64 0.63
65 0.56
66 0.58
67 0.58
68 0.62
69 0.61
70 0.57
71 0.51
72 0.49
73 0.48