Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A2G4T5F3

Protein Details
Accession A0A2G4T5F3   
Localization Confidence Medium
Confidence Score 10.6
NoLS Segment(s)
PositionSequenceProtein Nature
1-21MGRKKIKIQKIQDERNRQVTFHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 19.5, cyto_nucl 11.5, mito 4
Family & Domain DBs
InterPro View protein in InterPro  
IPR033896  MADS_MEF2-like  
IPR002100  TF_MADSbox  
IPR036879  TF_MADSbox_sf  
Gene Ontology GO:0005634  C:nucleus  
GO:0046983  F:protein dimerization activity  
GO:0000977  F:RNA polymerase II transcription regulatory region sequence-specific DNA binding  
GO:0006351  P:DNA-templated transcription  
GO:0045944  P:positive regulation of transcription by RNA polymerase II  
Pfam View protein in Pfam  
PF00319  SRF-TF  
PROSITE View protein in PROSITE  
PS00350  MADS_BOX_1  
PS50066  MADS_BOX_2  
CDD cd00265  MADS_MEF2_like  
Amino Acid Sequences MGRKKIKIQKIQDERNRQVTFLKRKQGLMKKAYELSVLCDCEIALLIFNTNGKLVQYASTDIDQILMKYTEVNMDNIKTIYNNLTYIIV
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.83
2 0.83
3 0.74
4 0.64
5 0.6
6 0.59
7 0.6
8 0.57
9 0.6
10 0.53
11 0.56
12 0.65
13 0.67
14 0.66
15 0.61
16 0.58
17 0.53
18 0.52
19 0.48
20 0.41
21 0.32
22 0.27
23 0.25
24 0.21
25 0.17
26 0.15
27 0.14
28 0.12
29 0.12
30 0.08
31 0.04
32 0.04
33 0.04
34 0.04
35 0.04
36 0.05
37 0.05
38 0.05
39 0.04
40 0.05
41 0.06
42 0.07
43 0.08
44 0.1
45 0.12
46 0.12
47 0.12
48 0.11
49 0.13
50 0.11
51 0.1
52 0.1
53 0.09
54 0.09
55 0.09
56 0.1
57 0.13
58 0.14
59 0.16
60 0.16
61 0.16
62 0.18
63 0.18
64 0.18
65 0.14
66 0.15
67 0.17
68 0.16
69 0.16