Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A2G4SPV1

Protein Details
Accession A0A2G4SPV1   
Localization Confidence High
Confidence Score 15.9
NoLS Segment(s)
PositionSequenceProtein Nature
1-26MNPVGRVRRPRIRKRDPNHIPRPMNSHydrophilic
81-110TKMYPDYKFNPKKRKSPSGNKRPERKIAVAHydrophilic
NLS Segment(s)
PositionSequence
7-15VRRPRIRKR
91-106PKKRKSPSGNKRPERK
Subcellular Location(s) nucl 19, mito_nucl 12.833, cyto_nucl 11.333, mito 5.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR009071  HMG_box_dom  
IPR036910  HMG_box_dom_sf  
Gene Ontology GO:0005634  C:nucleus  
GO:0003677  F:DNA binding  
Pfam View protein in Pfam  
PF00505  HMG_box  
PROSITE View protein in PROSITE  
PS50118  HMG_BOX_2  
CDD cd01389  HMG-box_ROX1-like  
Amino Acid Sequences MNPVGRVRRPRIRKRDPNHIPRPMNSFLSYRTEMQAVIRKHCPLANHREISKVVAKWWHEASDEEKQVFRNKAEVAKGEHTKMYPDYKFNPKKRKSPSGNKRPERKIAVAEEESQDKQER
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.86
2 0.89
3 0.9
4 0.9
5 0.89
6 0.88
7 0.81
8 0.74
9 0.73
10 0.66
11 0.58
12 0.5
13 0.41
14 0.34
15 0.36
16 0.35
17 0.3
18 0.27
19 0.24
20 0.22
21 0.23
22 0.28
23 0.23
24 0.25
25 0.27
26 0.26
27 0.27
28 0.28
29 0.28
30 0.27
31 0.35
32 0.39
33 0.39
34 0.39
35 0.4
36 0.39
37 0.39
38 0.38
39 0.28
40 0.22
41 0.23
42 0.24
43 0.23
44 0.24
45 0.22
46 0.17
47 0.18
48 0.21
49 0.23
50 0.23
51 0.21
52 0.21
53 0.21
54 0.25
55 0.26
56 0.22
57 0.19
58 0.19
59 0.22
60 0.24
61 0.25
62 0.24
63 0.29
64 0.31
65 0.29
66 0.29
67 0.25
68 0.25
69 0.26
70 0.28
71 0.24
72 0.26
73 0.3
74 0.4
75 0.49
76 0.56
77 0.64
78 0.65
79 0.72
80 0.77
81 0.83
82 0.82
83 0.83
84 0.85
85 0.86
86 0.9
87 0.9
88 0.91
89 0.88
90 0.87
91 0.82
92 0.76
93 0.71
94 0.66
95 0.65
96 0.57
97 0.53
98 0.47
99 0.44
100 0.41