Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A2G4SPK0

Protein Details
Accession A0A2G4SPK0   
Localization Confidence High
Confidence Score 16.2
NoLS Segment(s)
PositionSequenceProtein Nature
7-30HMRSPSPERHSKRHYSRYRSDSREBasic
80-101DEDSRRKRYSRHQQELKPINNIHydrophilic
NLS Segment(s)
PositionSequence
33-87KRDSRDRRQRSDSRDYSPRRTSRDYSPKRRRSVSRDEDSRRRRSVSRDEDSRRKR
Subcellular Location(s) nucl 24.5, cyto_nucl 15
Family & Domain DBs
Amino Acid Sequences MSERSRHMRSPSPERHSKRHYSRYRSDSREYEKRDSRDRRQRSDSRDYSPRRTSRDYSPKRRRSVSRDEDSRRRRSVSRDEDSRRKRYSRHQQELKPINNIPILPGESFSD
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.75
2 0.78
3 0.77
4 0.8
5 0.79
6 0.8
7 0.81
8 0.8
9 0.83
10 0.83
11 0.84
12 0.8
13 0.76
14 0.74
15 0.72
16 0.72
17 0.69
18 0.68
19 0.66
20 0.65
21 0.68
22 0.69
23 0.71
24 0.73
25 0.74
26 0.73
27 0.75
28 0.77
29 0.75
30 0.77
31 0.71
32 0.66
33 0.68
34 0.64
35 0.62
36 0.64
37 0.6
38 0.55
39 0.56
40 0.53
41 0.54
42 0.6
43 0.62
44 0.65
45 0.71
46 0.74
47 0.74
48 0.78
49 0.74
50 0.71
51 0.72
52 0.7
53 0.68
54 0.69
55 0.71
56 0.75
57 0.76
58 0.76
59 0.68
60 0.62
61 0.56
62 0.54
63 0.58
64 0.58
65 0.58
66 0.6
67 0.64
68 0.71
69 0.76
70 0.77
71 0.73
72 0.67
73 0.65
74 0.66
75 0.7
76 0.71
77 0.74
78 0.75
79 0.76
80 0.83
81 0.87
82 0.81
83 0.76
84 0.66
85 0.59
86 0.52
87 0.45
88 0.36
89 0.31
90 0.29
91 0.22