Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A2G4SW90

Protein Details
Accession A0A2G4SW90   
Localization Confidence Low
Confidence Score 9.5
NoLS Segment(s)
PositionSequenceProtein Nature
11-36FDTTKWKKKLTIPLKRHRNNVHWNGSHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 21.5, cyto_nucl 14.333, mito_nucl 11.666
Family & Domain DBs
Amino Acid Sequences MLLNSNSTSYFDTTKWKKKLTIPLKRHRNNVHWNGSATAKAAATEKFIRRNKQEVLSEDLTASQFANITGIKKTKRYEEEAHLSDDDADSTTTSASQPLSIWDSHFWHNDRQTETSITSSASQPCISSLTSLPLTRHKSEPGVIQKGRFKITWGMDDESAMITPEINCVEWKRKKNM
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.45
2 0.5
3 0.52
4 0.56
5 0.61
6 0.71
7 0.72
8 0.74
9 0.74
10 0.78
11 0.85
12 0.85
13 0.87
14 0.84
15 0.82
16 0.82
17 0.81
18 0.78
19 0.71
20 0.66
21 0.58
22 0.52
23 0.43
24 0.33
25 0.25
26 0.16
27 0.14
28 0.14
29 0.12
30 0.15
31 0.2
32 0.23
33 0.31
34 0.37
35 0.43
36 0.46
37 0.52
38 0.52
39 0.53
40 0.55
41 0.48
42 0.5
43 0.45
44 0.41
45 0.34
46 0.31
47 0.23
48 0.19
49 0.15
50 0.08
51 0.06
52 0.06
53 0.07
54 0.07
55 0.08
56 0.1
57 0.14
58 0.15
59 0.19
60 0.21
61 0.27
62 0.3
63 0.35
64 0.38
65 0.4
66 0.46
67 0.43
68 0.44
69 0.37
70 0.33
71 0.26
72 0.22
73 0.15
74 0.08
75 0.07
76 0.04
77 0.04
78 0.04
79 0.04
80 0.05
81 0.05
82 0.05
83 0.05
84 0.05
85 0.07
86 0.09
87 0.09
88 0.1
89 0.11
90 0.14
91 0.16
92 0.19
93 0.2
94 0.23
95 0.27
96 0.3
97 0.31
98 0.3
99 0.3
100 0.28
101 0.28
102 0.24
103 0.2
104 0.17
105 0.16
106 0.16
107 0.16
108 0.15
109 0.15
110 0.13
111 0.14
112 0.14
113 0.13
114 0.13
115 0.11
116 0.14
117 0.16
118 0.18
119 0.19
120 0.25
121 0.3
122 0.32
123 0.34
124 0.32
125 0.32
126 0.33
127 0.4
128 0.41
129 0.45
130 0.44
131 0.47
132 0.5
133 0.51
134 0.52
135 0.43
136 0.37
137 0.36
138 0.38
139 0.39
140 0.37
141 0.37
142 0.34
143 0.34
144 0.32
145 0.25
146 0.21
147 0.15
148 0.11
149 0.08
150 0.08
151 0.1
152 0.11
153 0.11
154 0.13
155 0.17
156 0.28
157 0.36