Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A2G4SSV4

Protein Details
Accession A0A2G4SSV4   
Localization Confidence Medium
Confidence Score 13.8
NoLS Segment(s)
PositionSequenceProtein Nature
114-146EDEERTAKKRAKRQRRNKKKQEKSNNIEEKKEKBasic
NLS Segment(s)
PositionSequence
118-153RTAKKRAKRQRRNKKKQEKSNNIEEKKEKEEEKERA
Subcellular Location(s) nucl 22, cyto_nucl 13, mito 3
Family & Domain DBs
InterPro View protein in InterPro  
IPR009548  Prkrip1  
Gene Ontology GO:0003725  F:double-stranded RNA binding  
Pfam View protein in Pfam  
PF06658  DUF1168  
Amino Acid Sequences MSTEINEKPSNGKNKHNLTPAQKQQKELEKLFERIDKPVQIPTPPPTDKNPVPPPKDFVRNVSGSSAGAGSGDFHVYRAQRRREYARLKFMEDQEKQEKEQREYQERLARLREEDEERTAKKRAKRQRRNKKKQEKSNNIEEKKEKEEEKERA
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.61
2 0.68
3 0.69
4 0.69
5 0.66
6 0.72
7 0.73
8 0.75
9 0.7
10 0.66
11 0.66
12 0.68
13 0.68
14 0.6
15 0.59
16 0.52
17 0.53
18 0.52
19 0.51
20 0.42
21 0.39
22 0.41
23 0.35
24 0.31
25 0.34
26 0.33
27 0.29
28 0.31
29 0.3
30 0.34
31 0.33
32 0.34
33 0.33
34 0.39
35 0.39
36 0.45
37 0.51
38 0.51
39 0.54
40 0.53
41 0.53
42 0.51
43 0.56
44 0.48
45 0.42
46 0.39
47 0.36
48 0.35
49 0.31
50 0.26
51 0.19
52 0.18
53 0.13
54 0.08
55 0.06
56 0.05
57 0.05
58 0.04
59 0.05
60 0.05
61 0.05
62 0.08
63 0.09
64 0.15
65 0.21
66 0.27
67 0.3
68 0.34
69 0.4
70 0.47
71 0.55
72 0.56
73 0.59
74 0.55
75 0.55
76 0.55
77 0.54
78 0.54
79 0.46
80 0.46
81 0.43
82 0.42
83 0.4
84 0.42
85 0.43
86 0.38
87 0.43
88 0.44
89 0.44
90 0.46
91 0.51
92 0.51
93 0.48
94 0.48
95 0.44
96 0.39
97 0.33
98 0.33
99 0.31
100 0.29
101 0.3
102 0.31
103 0.33
104 0.33
105 0.35
106 0.38
107 0.4
108 0.42
109 0.49
110 0.55
111 0.61
112 0.7
113 0.78
114 0.84
115 0.9
116 0.95
117 0.96
118 0.97
119 0.96
120 0.96
121 0.97
122 0.96
123 0.92
124 0.92
125 0.91
126 0.84
127 0.81
128 0.76
129 0.7
130 0.65
131 0.65
132 0.56
133 0.54