Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

J0WNU7

Protein Details
Accession J0WNU7   
Localization Confidence Low
Confidence Score 7
NoLS Segment(s)
PositionSequenceProtein Nature
225-245SEHARSRAPRRRSCARRHVQLHydrophilic
259-280VDRSCLRQRRKGLPGPLCRRHLHydrophilic
NLS Segment(s)
Subcellular Location(s) extr 9, cyto 6, mito 5, cyto_nucl 5
Family & Domain DBs
KEGG adl:AURDEDRAFT_117857  -  
Amino Acid Sequences MAKASWGGRAPRPPDSGDPFVVAAGGALNIKLAMNVRLGGTSVIPFFVVRRAWASRPVQELDRPEINCLSLCLTCSASTTSQDRVTPVHLSVLVAASAHEEVVYSLQFPIQHTLIKVPRVLPTSKVDASPSYLCRGSMGSRSLHVALGNAALWPVSPACTTCVATAFLPPAARSTSLSTGTRWGGYILSTSRQRPRSMRAYTVGILGQYCSSIGVACAHALSSASEHARSRAPRRRSCARRHVQLLLPLPPACKAAARVDRSCLRQRRKGLPGPLCRRHLSSSAGSAEVGVLRTFAVAPAAHCKTSTAPVSSRLW
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.52
2 0.55
3 0.54
4 0.47
5 0.44
6 0.37
7 0.33
8 0.29
9 0.21
10 0.13
11 0.08
12 0.07
13 0.05
14 0.05
15 0.05
16 0.05
17 0.05
18 0.07
19 0.08
20 0.09
21 0.1
22 0.11
23 0.11
24 0.11
25 0.12
26 0.12
27 0.11
28 0.11
29 0.1
30 0.09
31 0.09
32 0.09
33 0.09
34 0.13
35 0.13
36 0.12
37 0.17
38 0.21
39 0.23
40 0.31
41 0.35
42 0.36
43 0.4
44 0.42
45 0.4
46 0.4
47 0.43
48 0.4
49 0.42
50 0.37
51 0.35
52 0.33
53 0.3
54 0.26
55 0.23
56 0.19
57 0.13
58 0.14
59 0.13
60 0.13
61 0.13
62 0.14
63 0.16
64 0.14
65 0.17
66 0.18
67 0.2
68 0.22
69 0.22
70 0.22
71 0.21
72 0.22
73 0.21
74 0.19
75 0.18
76 0.15
77 0.15
78 0.14
79 0.13
80 0.1
81 0.08
82 0.07
83 0.07
84 0.06
85 0.06
86 0.05
87 0.04
88 0.05
89 0.06
90 0.06
91 0.05
92 0.05
93 0.06
94 0.08
95 0.08
96 0.11
97 0.11
98 0.13
99 0.13
100 0.19
101 0.21
102 0.22
103 0.22
104 0.2
105 0.24
106 0.26
107 0.26
108 0.23
109 0.24
110 0.27
111 0.27
112 0.26
113 0.24
114 0.21
115 0.24
116 0.24
117 0.21
118 0.19
119 0.18
120 0.17
121 0.16
122 0.17
123 0.15
124 0.16
125 0.17
126 0.14
127 0.15
128 0.17
129 0.17
130 0.16
131 0.14
132 0.1
133 0.08
134 0.08
135 0.07
136 0.06
137 0.05
138 0.04
139 0.04
140 0.04
141 0.04
142 0.04
143 0.04
144 0.04
145 0.06
146 0.08
147 0.09
148 0.09
149 0.1
150 0.11
151 0.11
152 0.11
153 0.1
154 0.1
155 0.09
156 0.09
157 0.09
158 0.09
159 0.09
160 0.1
161 0.12
162 0.14
163 0.17
164 0.18
165 0.17
166 0.19
167 0.19
168 0.18
169 0.15
170 0.13
171 0.1
172 0.09
173 0.11
174 0.09
175 0.13
176 0.15
177 0.19
178 0.26
179 0.29
180 0.33
181 0.34
182 0.4
183 0.45
184 0.45
185 0.46
186 0.42
187 0.42
188 0.39
189 0.37
190 0.31
191 0.22
192 0.18
193 0.14
194 0.11
195 0.07
196 0.06
197 0.05
198 0.05
199 0.04
200 0.05
201 0.06
202 0.06
203 0.06
204 0.06
205 0.06
206 0.06
207 0.06
208 0.06
209 0.06
210 0.08
211 0.09
212 0.11
213 0.12
214 0.14
215 0.19
216 0.24
217 0.33
218 0.4
219 0.48
220 0.54
221 0.61
222 0.7
223 0.74
224 0.79
225 0.81
226 0.8
227 0.8
228 0.77
229 0.76
230 0.69
231 0.67
232 0.61
233 0.55
234 0.49
235 0.41
236 0.36
237 0.31
238 0.28
239 0.21
240 0.18
241 0.17
242 0.23
243 0.3
244 0.36
245 0.36
246 0.42
247 0.47
248 0.52
249 0.59
250 0.59
251 0.6
252 0.62
253 0.68
254 0.71
255 0.75
256 0.77
257 0.78
258 0.78
259 0.8
260 0.82
261 0.82
262 0.78
263 0.72
264 0.67
265 0.62
266 0.56
267 0.51
268 0.44
269 0.41
270 0.38
271 0.36
272 0.32
273 0.27
274 0.24
275 0.2
276 0.17
277 0.11
278 0.08
279 0.08
280 0.08
281 0.08
282 0.08
283 0.09
284 0.09
285 0.11
286 0.19
287 0.23
288 0.22
289 0.23
290 0.24
291 0.25
292 0.31
293 0.34
294 0.31
295 0.3