Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A2G4T2G6

Protein Details
Accession A0A2G4T2G6   
Localization Confidence Medium
Confidence Score 14.2
NoLS Segment(s)
PositionSequenceProtein Nature
116-138QRRNAEKARCRKCIEKREKEDVWBasic
NLS Segment(s)
Subcellular Location(s) nucl 24, cyto 2
Family & Domain DBs
InterPro View protein in InterPro  
IPR024630  Stc1  
IPR043069  Stc1_sf  
Pfam View protein in Pfam  
PF12898  Stc1  
Amino Acid Sequences MNLQQTNKFYSPHSATNANSKYDYLQQLAHNITFSFLTDNQRLQKLRCVFCNTDKPLDAFSQTQISKATFNPYAPPSYNKKPKQVTCKSCTSRQNTHLTCMICNKRQPLDKFAKSQRRNAEKARCRKCIEKREKEDVWASEPDTDSDDEYDF
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.39
2 0.38
3 0.47
4 0.48
5 0.42
6 0.38
7 0.33
8 0.31
9 0.33
10 0.35
11 0.26
12 0.27
13 0.25
14 0.29
15 0.31
16 0.29
17 0.23
18 0.2
19 0.19
20 0.15
21 0.14
22 0.13
23 0.13
24 0.18
25 0.19
26 0.23
27 0.25
28 0.31
29 0.32
30 0.3
31 0.36
32 0.39
33 0.4
34 0.42
35 0.46
36 0.43
37 0.49
38 0.56
39 0.52
40 0.48
41 0.46
42 0.41
43 0.36
44 0.33
45 0.28
46 0.2
47 0.17
48 0.19
49 0.18
50 0.18
51 0.17
52 0.17
53 0.16
54 0.16
55 0.19
56 0.14
57 0.15
58 0.17
59 0.17
60 0.19
61 0.19
62 0.22
63 0.24
64 0.32
65 0.42
66 0.42
67 0.49
68 0.54
69 0.59
70 0.65
71 0.69
72 0.69
73 0.64
74 0.71
75 0.67
76 0.67
77 0.68
78 0.65
79 0.62
80 0.6
81 0.65
82 0.56
83 0.55
84 0.52
85 0.45
86 0.39
87 0.41
88 0.4
89 0.35
90 0.37
91 0.38
92 0.39
93 0.46
94 0.48
95 0.48
96 0.52
97 0.53
98 0.57
99 0.63
100 0.68
101 0.64
102 0.69
103 0.71
104 0.69
105 0.7
106 0.71
107 0.72
108 0.71
109 0.78
110 0.79
111 0.77
112 0.74
113 0.78
114 0.79
115 0.79
116 0.81
117 0.81
118 0.81
119 0.82
120 0.79
121 0.74
122 0.71
123 0.62
124 0.56
125 0.48
126 0.4
127 0.35
128 0.34
129 0.3
130 0.26
131 0.23
132 0.2