Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A2G4SKM8

Protein Details
Accession A0A2G4SKM8   
Localization Confidence Medium
Confidence Score 11.8
NoLS Segment(s)
PositionSequenceProtein Nature
59-88EEALNKLRQKYKKKRIKKVIRKIRNSVGGIHydrophilic
NLS Segment(s)
PositionSequence
65-82LRQKYKKKRIKKVIRKIR
Subcellular Location(s) mito 16, nucl 10
Family & Domain DBs
Amino Acid Sequences MSKKRPKNIHPKIANAIITSVEIPLLPADIRNTFTRPDTIRLYIPKEEERDSEEEKEEEEALNKLRQKYKKKRIKKVIRKIRNSVGGIRFTVVWENDEEEVY
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.66
2 0.55
3 0.45
4 0.35
5 0.29
6 0.23
7 0.16
8 0.1
9 0.07
10 0.07
11 0.06
12 0.06
13 0.05
14 0.06
15 0.08
16 0.09
17 0.12
18 0.14
19 0.15
20 0.16
21 0.17
22 0.21
23 0.21
24 0.24
25 0.25
26 0.25
27 0.27
28 0.29
29 0.32
30 0.29
31 0.3
32 0.29
33 0.28
34 0.27
35 0.25
36 0.25
37 0.25
38 0.25
39 0.24
40 0.21
41 0.19
42 0.18
43 0.18
44 0.15
45 0.11
46 0.1
47 0.09
48 0.1
49 0.14
50 0.16
51 0.2
52 0.27
53 0.35
54 0.45
55 0.55
56 0.64
57 0.71
58 0.79
59 0.86
60 0.9
61 0.93
62 0.94
63 0.94
64 0.94
65 0.94
66 0.92
67 0.88
68 0.85
69 0.83
70 0.74
71 0.71
72 0.65
73 0.58
74 0.5
75 0.44
76 0.35
77 0.28
78 0.3
79 0.22
80 0.18
81 0.17
82 0.19