Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A2G4SR76

Protein Details
Accession A0A2G4SR76    Localization Confidence Medium Confidence Score 10.7
NoLS Segment(s)
PositionSequenceProtein Nature
70-91RLDEIARRKRRGKGAPKKGKLRBasic
NLS Segment(s)
PositionSequence
75-91ARRKRRGKGAPKKGKLR
Subcellular Location(s) mito 17, nucl 8.5, cyto_nucl 5.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR013219  Ribosomal_S27/S33_mit  
Gene Ontology GO:0005739  C:mitochondrion  
GO:1990904  C:ribonucleoprotein complex  
GO:0005840  C:ribosome  
Pfam View protein in Pfam  
PF08293  MRP-S33  
Amino Acid Sequences ARLSELKQLSCKIFSTVYNPTCARTGNKILRQRLLGPTLTGYHPKPLVHFRDIQALYPQLGLIDVDEKARLDEIARRKRRGKGAPKKGKLR
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.26
2 0.28
3 0.33
4 0.31
5 0.35
6 0.34
7 0.33
8 0.32
9 0.32
10 0.3
11 0.27
12 0.35
13 0.37
14 0.45
15 0.51
16 0.54
17 0.55
18 0.54
19 0.51
20 0.46
21 0.4
22 0.33
23 0.25
24 0.23
25 0.21
26 0.2
27 0.2
28 0.16
29 0.15
30 0.17
31 0.16
32 0.17
33 0.21
34 0.25
35 0.24
36 0.27
37 0.25
38 0.32
39 0.32
40 0.31
41 0.28
42 0.24
43 0.22
44 0.19
45 0.18
46 0.09
47 0.08
48 0.07
49 0.05
50 0.06
51 0.06
52 0.06
53 0.07
54 0.07
55 0.08
56 0.08
57 0.08
58 0.08
59 0.15
60 0.24
61 0.35
62 0.43
63 0.49
64 0.55
65 0.63
66 0.72
67 0.76
68 0.77
69 0.77
70 0.81
71 0.85