Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A2G4SNW9

Protein Details
Accession A0A2G4SNW9    Localization Confidence Low Confidence Score 5
NoLS Segment(s)
PositionSequenceProtein Nature
32-51YLKYLKNRSNKDKTKRGSDEHydrophilic
NLS Segment(s)
Subcellular Location(s) mito 22.5, cyto_mito 13.5, cyto 3.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR023799  RbfA_dom_sf  
Amino Acid Sequences MQRFLRGFATKANRYTPEAQVILQDTMVPGAYLKYLKNRSNKDKTKRGSDEVPMYTEPARSMTFGQKSDGPTQAQMRLADRVRKAMTKVQAVEDLPTNWLSQLRVADVKVARNLKRCQIEYEPIANEQGKVHNAVRKHSRLLNTLINQHAQTEHTIHIKFISHEHKDIDEVYNTIEKELDSL
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.49
2 0.53
3 0.48
4 0.46
5 0.41
6 0.38
7 0.35
8 0.34
9 0.29
10 0.24
11 0.2
12 0.13
13 0.12
14 0.12
15 0.09
16 0.06
17 0.05
18 0.07
19 0.09
20 0.1
21 0.19
22 0.26
23 0.33
24 0.42
25 0.5
26 0.59
27 0.68
28 0.76
29 0.77
30 0.8
31 0.79
32 0.81
33 0.78
34 0.73
35 0.67
36 0.63
37 0.61
38 0.52
39 0.5
40 0.39
41 0.35
42 0.31
43 0.26
44 0.2
45 0.15
46 0.14
47 0.12
48 0.14
49 0.19
50 0.22
51 0.22
52 0.23
53 0.24
54 0.27
55 0.29
56 0.29
57 0.24
58 0.23
59 0.24
60 0.25
61 0.24
62 0.22
63 0.2
64 0.22
65 0.24
66 0.26
67 0.25
68 0.26
69 0.25
70 0.26
71 0.27
72 0.27
73 0.29
74 0.27
75 0.28
76 0.25
77 0.26
78 0.24
79 0.23
80 0.19
81 0.15
82 0.12
83 0.12
84 0.1
85 0.08
86 0.09
87 0.08
88 0.09
89 0.09
90 0.09
91 0.1
92 0.1
93 0.14
94 0.15
95 0.17
96 0.2
97 0.25
98 0.27
99 0.33
100 0.35
101 0.37
102 0.42
103 0.42
104 0.42
105 0.41
106 0.43
107 0.4
108 0.42
109 0.36
110 0.3
111 0.32
112 0.27
113 0.23
114 0.19
115 0.18
116 0.15
117 0.17
118 0.19
119 0.2
120 0.21
121 0.27
122 0.34
123 0.35
124 0.38
125 0.39
126 0.41
127 0.42
128 0.46
129 0.47
130 0.43
131 0.44
132 0.43
133 0.4
134 0.36
135 0.33
136 0.29
137 0.21
138 0.2
139 0.17
140 0.18
141 0.21
142 0.21
143 0.2
144 0.21
145 0.22
146 0.21
147 0.26
148 0.32
149 0.31
150 0.33
151 0.35
152 0.34
153 0.34
154 0.35
155 0.32
156 0.25
157 0.21
158 0.22
159 0.24
160 0.23
161 0.21
162 0.2