Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A2G4SNI6

Protein Details
Accession A0A2G4SNI6    Localization Confidence Low Confidence Score 9.7
NoLS Segment(s)
PositionSequenceProtein Nature
1-22MSQKKRGAKSRRTQKVYQCTGYHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 16.5, cyto_nucl 9.5, mito 9
Family & Domain DBs
InterPro View protein in InterPro  
IPR013087  Znf_C2H2_type  
Pfam View protein in Pfam  
PF00096  zf-C2H2  
PROSITE View protein in PROSITE  
PS50157  ZINC_FINGER_C2H2_2  
Amino Acid Sequences MSQKKRGAKSRRTQKVYQCTGYGNCTMTFTRSEQLVRHLKRHRDEMPSVTTATTNTTAATATVNTFGDASVIPTAVLPDNNIVYLDLTCNRQGHDEDDEDEDIVSPSTHDYAETMLYSFVDNSPHVADLLWSKQQLGQSEFLKLAPETNEELVLEIPHPTPSISTHDICLF
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.85
2 0.85
3 0.83
4 0.76
5 0.67
6 0.61
7 0.56
8 0.52
9 0.44
10 0.35
11 0.27
12 0.26
13 0.24
14 0.21
15 0.22
16 0.2
17 0.2
18 0.2
19 0.21
20 0.2
21 0.28
22 0.36
23 0.36
24 0.43
25 0.49
26 0.54
27 0.57
28 0.64
29 0.61
30 0.58
31 0.59
32 0.55
33 0.52
34 0.46
35 0.42
36 0.34
37 0.29
38 0.22
39 0.21
40 0.17
41 0.12
42 0.1
43 0.1
44 0.09
45 0.09
46 0.1
47 0.07
48 0.06
49 0.08
50 0.08
51 0.08
52 0.08
53 0.07
54 0.07
55 0.06
56 0.07
57 0.06
58 0.06
59 0.05
60 0.05
61 0.06
62 0.06
63 0.06
64 0.05
65 0.06
66 0.06
67 0.06
68 0.06
69 0.05
70 0.05
71 0.05
72 0.06
73 0.06
74 0.08
75 0.1
76 0.1
77 0.1
78 0.12
79 0.12
80 0.14
81 0.16
82 0.15
83 0.15
84 0.17
85 0.16
86 0.15
87 0.14
88 0.12
89 0.09
90 0.08
91 0.06
92 0.04
93 0.05
94 0.05
95 0.05
96 0.05
97 0.05
98 0.06
99 0.07
100 0.07
101 0.07
102 0.06
103 0.07
104 0.07
105 0.07
106 0.07
107 0.08
108 0.08
109 0.09
110 0.1
111 0.1
112 0.1
113 0.09
114 0.1
115 0.11
116 0.14
117 0.16
118 0.15
119 0.15
120 0.18
121 0.21
122 0.24
123 0.24
124 0.26
125 0.24
126 0.26
127 0.26
128 0.24
129 0.23
130 0.19
131 0.18
132 0.15
133 0.17
134 0.18
135 0.18
136 0.19
137 0.17
138 0.17
139 0.15
140 0.14
141 0.12
142 0.11
143 0.1
144 0.1
145 0.11
146 0.1
147 0.11
148 0.13
149 0.2
150 0.23
151 0.24