Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A2G4SIR0

Protein Details
Accession A0A2G4SIR0   
Localization Confidence Medium
Confidence Score 12.9
NoLS Segment(s)
PositionSequenceProtein Nature
79-122RITKPNKKPVRQPPQKKQQQKQKPKNDKKGTKEKKKPLSQEDLDBasic
NLS Segment(s)
PositionSequence
58-115KSIQQRLGKPVDTRRKPAMAGRITKPNKKPVRQPPQKKQQQKQKPKNDKKGTKEKKKP
Subcellular Location(s) nucl 17.5, cyto_nucl 10, mito 8
Family & Domain DBs
InterPro View protein in InterPro  
IPR025715  FoP_C  
Gene Ontology GO:0003723  F:RNA binding  
Pfam View protein in Pfam  
PF13865  FoP_duplication  
Amino Acid Sequences MSPNTRRVVTNARTVSYSSGGLNERFANLEKSKKPTHNPVIQSKSVFSRIKADSPKSKSIQQRLGKPVDTRRKPAMAGRITKPNKKPVRQPPQKKQQQKQKPKNDKKGTKEKKKPLSQEDLDKSLDAYMMKDPKTAQAKLDEELTTYMQEAELEEETL
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.42
2 0.39
3 0.32
4 0.28
5 0.19
6 0.2
7 0.21
8 0.2
9 0.21
10 0.19
11 0.17
12 0.18
13 0.19
14 0.21
15 0.22
16 0.29
17 0.31
18 0.37
19 0.44
20 0.49
21 0.53
22 0.58
23 0.64
24 0.64
25 0.66
26 0.69
27 0.69
28 0.65
29 0.6
30 0.52
31 0.46
32 0.45
33 0.4
34 0.31
35 0.31
36 0.31
37 0.36
38 0.4
39 0.42
40 0.43
41 0.48
42 0.54
43 0.49
44 0.54
45 0.54
46 0.56
47 0.6
48 0.57
49 0.59
50 0.59
51 0.59
52 0.55
53 0.51
54 0.53
55 0.54
56 0.52
57 0.49
58 0.46
59 0.44
60 0.43
61 0.43
62 0.42
63 0.37
64 0.38
65 0.36
66 0.43
67 0.44
68 0.5
69 0.5
70 0.51
71 0.53
72 0.53
73 0.6
74 0.61
75 0.69
76 0.73
77 0.8
78 0.8
79 0.83
80 0.89
81 0.89
82 0.87
83 0.86
84 0.87
85 0.88
86 0.88
87 0.89
88 0.91
89 0.92
90 0.94
91 0.94
92 0.92
93 0.89
94 0.9
95 0.9
96 0.89
97 0.89
98 0.88
99 0.88
100 0.87
101 0.86
102 0.83
103 0.81
104 0.75
105 0.74
106 0.69
107 0.63
108 0.55
109 0.46
110 0.39
111 0.29
112 0.26
113 0.16
114 0.13
115 0.15
116 0.19
117 0.2
118 0.21
119 0.21
120 0.28
121 0.34
122 0.34
123 0.31
124 0.34
125 0.36
126 0.35
127 0.39
128 0.31
129 0.26
130 0.27
131 0.25
132 0.18
133 0.16
134 0.15
135 0.11
136 0.11
137 0.1
138 0.11