Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A2G4SI71

Protein Details
Accession A0A2G4SI71    Localization Confidence High Confidence Score 16.4
NoLS Segment(s)
PositionSequenceProtein Nature
17-46NKLNSRETHSHKKKKETSGKKPKGKLDKSQBasic
116-142QPPPPPPRSSNQKTRPPPPPPRKIASVHydrophilic
NLS Segment(s)
PositionSequence
27-42HKKKKETSGKKPKGKL
119-145PPPPRSSNQKTRPPPPPPRKIASVGGK
Subcellular Location(s) nucl 17, cyto_nucl 13.5, cyto 8
Family & Domain DBs
InterPro View protein in InterPro  
IPR000095  CRIB_dom  
IPR036936  CRIB_dom_sf  
IPR039056  SPEC  
IPR011026  WAS_C  
Gene Ontology GO:0005856  C:cytoskeleton  
GO:0005886  C:plasma membrane  
GO:0031267  F:small GTPase binding  
GO:0007015  P:actin filament organization  
GO:0008360  P:regulation of cell shape  
GO:0035023  P:regulation of Rho protein signal transduction  
Pfam View protein in Pfam  
PF00786  PBD  
PROSITE View protein in PROSITE  
PS50108  CRIB  
Amino Acid Sequences MAGLSFADIDDADVFFNKLNSRETHSHKKKKETSGKKPKGKLDKSQIGLPSEFRHLGHIGYTPSKGFSVQNSSPEWNGFFDQLKDLGLTTTEINDNQEFIQDFVSKRGGFSQQRPQPPPPPPRSSNQKTRPPPPPPRKIASVGGK
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.09
2 0.09
3 0.11
4 0.12
5 0.13
6 0.17
7 0.18
8 0.25
9 0.32
10 0.4
11 0.5
12 0.58
13 0.66
14 0.7
15 0.78
16 0.79
17 0.83
18 0.86
19 0.85
20 0.86
21 0.87
22 0.91
23 0.89
24 0.87
25 0.85
26 0.85
27 0.81
28 0.79
29 0.77
30 0.75
31 0.69
32 0.67
33 0.61
34 0.53
35 0.47
36 0.39
37 0.31
38 0.26
39 0.24
40 0.19
41 0.18
42 0.16
43 0.15
44 0.14
45 0.14
46 0.13
47 0.14
48 0.14
49 0.12
50 0.12
51 0.12
52 0.12
53 0.11
54 0.11
55 0.17
56 0.17
57 0.2
58 0.21
59 0.22
60 0.22
61 0.21
62 0.2
63 0.14
64 0.14
65 0.12
66 0.11
67 0.1
68 0.11
69 0.11
70 0.1
71 0.09
72 0.08
73 0.07
74 0.06
75 0.07
76 0.06
77 0.07
78 0.08
79 0.08
80 0.1
81 0.1
82 0.11
83 0.09
84 0.11
85 0.1
86 0.1
87 0.12
88 0.12
89 0.12
90 0.14
91 0.18
92 0.16
93 0.17
94 0.19
95 0.25
96 0.28
97 0.33
98 0.42
99 0.45
100 0.54
101 0.59
102 0.62
103 0.62
104 0.67
105 0.71
106 0.69
107 0.7
108 0.65
109 0.68
110 0.72
111 0.72
112 0.74
113 0.74
114 0.76
115 0.76
116 0.81
117 0.83
118 0.82
119 0.85
120 0.85
121 0.86
122 0.83
123 0.81
124 0.78
125 0.73