Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A2G4SQP1

Protein Details
Accession A0A2G4SQP1    Localization Confidence Medium Confidence Score 10.2
NoLS Segment(s)
PositionSequenceProtein Nature
12-41LTKRIKTSRACDDCRKRKVKCDGKQPCARCHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 19.5, cyto_nucl 12, mito 6
Family & Domain DBs
InterPro View protein in InterPro  
IPR036864  Zn2-C6_fun-type_DNA-bd_sf  
IPR001138  Zn2Cys6_DnaBD  
Gene Ontology GO:0000981  F:DNA-binding transcription factor activity, RNA polymerase II-specific  
GO:0008270  F:zinc ion binding  
Pfam View protein in Pfam  
PF00172  Zn_clus  
PROSITE View protein in PROSITE  
PS00463  ZN2_CY6_FUNGAL_1  
PS50048  ZN2_CY6_FUNGAL_2  
CDD cd00067  GAL4  
Amino Acid Sequences MSGIFSLKTKSLTKRIKTSRACDDCRKRKVKCDGKQPCARCVKAKIECIFVKMPKRGPPKSYTESVENRLQRVEKALKSIATPVVNRVFDDSLKSKDPCNQIASTEGNTP
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.61
2 0.68
3 0.74
4 0.76
5 0.76
6 0.77
7 0.76
8 0.75
9 0.75
10 0.78
11 0.78
12 0.8
13 0.82
14 0.74
15 0.75
16 0.8
17 0.8
18 0.77
19 0.78
20 0.78
21 0.79
22 0.84
23 0.77
24 0.74
25 0.71
26 0.65
27 0.59
28 0.54
29 0.54
30 0.51
31 0.56
32 0.49
33 0.47
34 0.45
35 0.44
36 0.41
37 0.36
38 0.35
39 0.31
40 0.33
41 0.34
42 0.42
43 0.41
44 0.42
45 0.43
46 0.45
47 0.46
48 0.46
49 0.42
50 0.4
51 0.41
52 0.41
53 0.44
54 0.38
55 0.34
56 0.33
57 0.31
58 0.25
59 0.28
60 0.29
61 0.24
62 0.27
63 0.28
64 0.26
65 0.26
66 0.29
67 0.27
68 0.24
69 0.23
70 0.24
71 0.28
72 0.28
73 0.27
74 0.28
75 0.25
76 0.22
77 0.28
78 0.27
79 0.25
80 0.29
81 0.3
82 0.29
83 0.35
84 0.4
85 0.39
86 0.41
87 0.37
88 0.34
89 0.37
90 0.39