Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

E2M547

Protein Details
Accession E2M547   
Localization Confidence Medium
Confidence Score 13.2
NoLS Segment(s)
PositionSequenceProtein Nature
47-67PVEPLGKRRKRSTRSRSRALGBasic
NLS Segment(s)
PositionSequence
52-64GKRRKRSTRSRSR
Subcellular Location(s) nucl 17, mito 5.5, cyto_mito 5.5, cyto 4.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR028386  CENP-C/Mif2/cnp3  
IPR025974  Mif2/CENP-C_cupin  
IPR014710  RmlC-like_jellyroll  
Gene Ontology GO:0000776  C:kinetochore  
GO:0005634  C:nucleus  
GO:0019237  F:centromeric DNA binding  
GO:0051382  P:kinetochore assembly  
KEGG mpr:MPER_15542  -  
Pfam View protein in Pfam  
PF11699  CENP-C_C  
Amino Acid Sequences VRRSLRTSYKPLQYWRNEKVVYGRPSRQSEHILVPHIKEIIRIPEEPVEPLGKRRKRSTRSRSRALGGGTATPAPSDDPDDFPEKGWDDDTPERGLVIDWRTKELVEKRIACLAKNVIPQQANNSDWEFQKIFGDEQFIAAGQLIIPVGSRKPNKTTKDNTYVFCVLEGAVNVKINDLSMVLCQGAMFMVPR
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.74
2 0.71
3 0.71
4 0.63
5 0.58
6 0.59
7 0.58
8 0.56
9 0.54
10 0.55
11 0.54
12 0.59
13 0.6
14 0.57
15 0.53
16 0.5
17 0.5
18 0.46
19 0.45
20 0.42
21 0.4
22 0.37
23 0.33
24 0.29
25 0.23
26 0.23
27 0.24
28 0.24
29 0.24
30 0.24
31 0.27
32 0.27
33 0.27
34 0.26
35 0.22
36 0.2
37 0.27
38 0.34
39 0.35
40 0.4
41 0.48
42 0.57
43 0.62
44 0.73
45 0.77
46 0.78
47 0.81
48 0.84
49 0.79
50 0.72
51 0.67
52 0.57
53 0.49
54 0.38
55 0.3
56 0.23
57 0.19
58 0.16
59 0.11
60 0.1
61 0.08
62 0.07
63 0.09
64 0.09
65 0.11
66 0.13
67 0.17
68 0.17
69 0.17
70 0.18
71 0.16
72 0.16
73 0.14
74 0.12
75 0.14
76 0.16
77 0.18
78 0.16
79 0.15
80 0.15
81 0.14
82 0.14
83 0.11
84 0.12
85 0.13
86 0.12
87 0.14
88 0.14
89 0.14
90 0.19
91 0.21
92 0.25
93 0.28
94 0.29
95 0.28
96 0.34
97 0.35
98 0.3
99 0.29
100 0.25
101 0.24
102 0.27
103 0.27
104 0.25
105 0.26
106 0.26
107 0.28
108 0.3
109 0.26
110 0.24
111 0.24
112 0.22
113 0.21
114 0.25
115 0.21
116 0.17
117 0.17
118 0.16
119 0.15
120 0.13
121 0.16
122 0.12
123 0.13
124 0.12
125 0.1
126 0.09
127 0.09
128 0.08
129 0.04
130 0.05
131 0.04
132 0.04
133 0.04
134 0.05
135 0.07
136 0.14
137 0.19
138 0.22
139 0.3
140 0.39
141 0.46
142 0.54
143 0.6
144 0.62
145 0.68
146 0.69
147 0.63
148 0.61
149 0.57
150 0.48
151 0.4
152 0.31
153 0.21
154 0.18
155 0.17
156 0.12
157 0.12
158 0.14
159 0.14
160 0.14
161 0.14
162 0.13
163 0.12
164 0.1
165 0.09
166 0.08
167 0.09
168 0.08
169 0.08
170 0.08
171 0.07
172 0.07