Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A2G4SPB3

Protein Details
Accession A0A2G4SPB3    Localization Confidence Medium Confidence Score 13.3
NoLS Segment(s)
PositionSequenceProtein Nature
136-167QQHLLCKIDIRKKRHYRRKQRRQLHLAYCFSTHydrophilic
NLS Segment(s)
PositionSequence
146-157RKKRHYRRKQRR
Subcellular Location(s) nucl 17, mito 5, cyto 5, cyto_mito 5
Family & Domain DBs
InterPro View protein in InterPro  
IPR002885  Pentatricopeptide_repeat  
IPR011990  TPR-like_helical_dom_sf  
Pfam View protein in Pfam  
PF13041  PPR_2  
PROSITE View protein in PROSITE  
PS51375  PPR  
Amino Acid Sequences MVARTTKSMQTIEQLCQDMSCHVKRGNIALYNTLLKIFLNNNDVRKADRLYRQIKRHSTPTAMTYGILMDYASKRRDLRSMIKYLDDMAAYSIPVDYAIIEITVSTLCRVKAFDLAEEMVKELHRGCEKLVPPRFQQHLLCKIDIRKKRHYRRKQRRQLHLAYCFST
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.34
2 0.3
3 0.28
4 0.28
5 0.23
6 0.26
7 0.25
8 0.24
9 0.24
10 0.27
11 0.28
12 0.32
13 0.35
14 0.35
15 0.34
16 0.32
17 0.33
18 0.32
19 0.3
20 0.26
21 0.19
22 0.13
23 0.15
24 0.14
25 0.15
26 0.19
27 0.22
28 0.25
29 0.28
30 0.28
31 0.28
32 0.29
33 0.28
34 0.29
35 0.33
36 0.39
37 0.44
38 0.52
39 0.57
40 0.63
41 0.68
42 0.66
43 0.65
44 0.6
45 0.55
46 0.48
47 0.43
48 0.37
49 0.3
50 0.25
51 0.19
52 0.15
53 0.11
54 0.09
55 0.07
56 0.05
57 0.07
58 0.1
59 0.11
60 0.13
61 0.14
62 0.15
63 0.19
64 0.22
65 0.29
66 0.31
67 0.35
68 0.34
69 0.34
70 0.33
71 0.3
72 0.26
73 0.18
74 0.12
75 0.08
76 0.07
77 0.06
78 0.06
79 0.05
80 0.04
81 0.04
82 0.04
83 0.03
84 0.03
85 0.03
86 0.03
87 0.03
88 0.03
89 0.03
90 0.04
91 0.04
92 0.05
93 0.06
94 0.06
95 0.07
96 0.08
97 0.09
98 0.13
99 0.14
100 0.14
101 0.15
102 0.16
103 0.16
104 0.16
105 0.15
106 0.11
107 0.1
108 0.1
109 0.09
110 0.13
111 0.15
112 0.15
113 0.17
114 0.23
115 0.27
116 0.36
117 0.42
118 0.42
119 0.43
120 0.51
121 0.53
122 0.51
123 0.54
124 0.53
125 0.55
126 0.54
127 0.52
128 0.49
129 0.53
130 0.57
131 0.59
132 0.58
133 0.59
134 0.66
135 0.76
136 0.83
137 0.86
138 0.88
139 0.92
140 0.96
141 0.96
142 0.96
143 0.95
144 0.94
145 0.93
146 0.92
147 0.9