Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A2G4SU82

Protein Details
Accession A0A2G4SU82    Localization Confidence Medium Confidence Score 14.7
NoLS Segment(s)
PositionSequenceProtein Nature
1-26MAKSKNHTNHNQNKKAHRNGIKKPVIHydrophilic
NLS Segment(s)
PositionSequence
14-33KKAHRNGIKKPVIHKYRAQK
Subcellular Location(s) nucl 18, mito 5, cyto 4
Family & Domain DBs
InterPro View protein in InterPro  
IPR002673  Ribosomal_L29e  
Gene Ontology GO:1990904  C:ribonucleoprotein complex  
GO:0005840  C:ribosome  
GO:0003735  F:structural constituent of ribosome  
GO:0006412  P:translation  
Pfam View protein in Pfam  
PF01779  Ribosomal_L29e  
Amino Acid Sequences MAKSKNHTNHNQNKKAHRNGIKKPVIHKYRAQKSLDAKFLRNQRFAKKGTQKALAATKA
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.84
2 0.83
3 0.81
4 0.81
5 0.79
6 0.79
7 0.82
8 0.78
9 0.71
10 0.68
11 0.68
12 0.63
13 0.58
14 0.55
15 0.55
16 0.57
17 0.61
18 0.57
19 0.52
20 0.54
21 0.56
22 0.58
23 0.51
24 0.44
25 0.43
26 0.51
27 0.52
28 0.52
29 0.5
30 0.5
31 0.54
32 0.55
33 0.6
34 0.61
35 0.64
36 0.63
37 0.66
38 0.6
39 0.59