Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A2G4T7B3

Protein Details
Accession A0A2G4T7B3    Localization Confidence Low Confidence Score 8.9
NoLS Segment(s)
PositionSequenceProtein Nature
1-21KKPKRHSRKPTLKTKVVVRRLBasic
NLS Segment(s)
PositionSequence
2-13KPKRHSRKPTLK
Subcellular Location(s) mito 22.5, mito_nucl 13.5, nucl 3.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR012677  Nucleotide-bd_a/b_plait_sf  
IPR035979  RBD_domain_sf  
IPR039722  Upf3  
IPR005120  UPF3_dom  
Gene Ontology GO:0003676  F:nucleic acid binding  
GO:0000184  P:nuclear-transcribed mRNA catabolic process, nonsense-mediated decay  
Pfam View protein in Pfam  
PF03467  Smg4_UPF3  
CDD cd12455  RRM_like_Smg4_UPF3  
Amino Acid Sequences KKPKRHSRKPTLKTKVVVRRLPPLLQEDVLMEAVKPWINEQTTDYSFFVPGKIPKSKGKENIFSRAYFHLKTMEAVIAFHQGFDGRPFTDSRGKYI
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.83
2 0.82
3 0.79
4 0.76
5 0.68
6 0.67
7 0.64
8 0.59
9 0.52
10 0.46
11 0.39
12 0.33
13 0.3
14 0.22
15 0.19
16 0.18
17 0.15
18 0.1
19 0.08
20 0.08
21 0.09
22 0.08
23 0.07
24 0.11
25 0.11
26 0.12
27 0.14
28 0.18
29 0.18
30 0.21
31 0.21
32 0.17
33 0.18
34 0.17
35 0.15
36 0.12
37 0.13
38 0.15
39 0.18
40 0.21
41 0.27
42 0.34
43 0.4
44 0.47
45 0.5
46 0.55
47 0.55
48 0.61
49 0.56
50 0.51
51 0.47
52 0.43
53 0.41
54 0.32
55 0.29
56 0.24
57 0.22
58 0.22
59 0.21
60 0.18
61 0.14
62 0.14
63 0.14
64 0.16
65 0.15
66 0.14
67 0.13
68 0.11
69 0.12
70 0.14
71 0.16
72 0.12
73 0.13
74 0.15
75 0.2
76 0.28