Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A2G4SEV4

Protein Details
Accession A0A2G4SEV4    Localization Confidence Low Confidence Score 6.6
NoLS Segment(s)
PositionSequenceProtein Nature
156-179QIDNTKTLTRRRRWYRKAIPIHSLHydrophilic
NLS Segment(s)
Subcellular Location(s) extr 8, cyto_nucl 5, nucl 4.5, cyto 4.5, E.R. 4, plas 3
Family & Domain DBs
InterPro View protein in InterPro  
IPR010482  Peroxin  
IPR006614  Peroxin/Ferlin  
Gene Ontology GO:0005778  C:peroxisomal membrane  
GO:0007031  P:peroxisome organization  
Pfam View protein in Pfam  
PF06398  Pex24p  
Amino Acid Sequences MAGLLILFNKTWIGSFMEVVLLFLVELLQTCIDIIQKLALRTSTSERKPIEVSVYENQRWWAGTGYTSQMLRSERAAWSNITGLEPLPPKEDIPPPAHYTWTKDDWCLDAIGPWIDDVLGIVMTVDCDQDGWVYSDHKWSNPVGASELHKAGTNGQIDNTKTLTRRRRWYRKAIPIHSL
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.12
2 0.13
3 0.13
4 0.15
5 0.14
6 0.14
7 0.12
8 0.08
9 0.07
10 0.06
11 0.06
12 0.03
13 0.04
14 0.05
15 0.05
16 0.05
17 0.05
18 0.06
19 0.06
20 0.07
21 0.07
22 0.1
23 0.13
24 0.13
25 0.15
26 0.15
27 0.15
28 0.18
29 0.25
30 0.3
31 0.3
32 0.36
33 0.36
34 0.38
35 0.38
36 0.37
37 0.34
38 0.27
39 0.3
40 0.29
41 0.34
42 0.32
43 0.31
44 0.3
45 0.26
46 0.25
47 0.21
48 0.16
49 0.1
50 0.11
51 0.11
52 0.13
53 0.14
54 0.14
55 0.13
56 0.14
57 0.15
58 0.15
59 0.15
60 0.15
61 0.14
62 0.16
63 0.17
64 0.14
65 0.14
66 0.14
67 0.13
68 0.11
69 0.1
70 0.08
71 0.1
72 0.11
73 0.11
74 0.11
75 0.11
76 0.11
77 0.14
78 0.17
79 0.17
80 0.2
81 0.22
82 0.24
83 0.25
84 0.27
85 0.25
86 0.26
87 0.27
88 0.28
89 0.26
90 0.23
91 0.23
92 0.22
93 0.22
94 0.18
95 0.14
96 0.09
97 0.1
98 0.1
99 0.09
100 0.07
101 0.06
102 0.05
103 0.05
104 0.04
105 0.04
106 0.03
107 0.03
108 0.03
109 0.03
110 0.04
111 0.04
112 0.04
113 0.03
114 0.04
115 0.04
116 0.04
117 0.06
118 0.07
119 0.08
120 0.1
121 0.11
122 0.18
123 0.19
124 0.19
125 0.21
126 0.2
127 0.23
128 0.23
129 0.24
130 0.19
131 0.2
132 0.23
133 0.25
134 0.25
135 0.21
136 0.2
137 0.2
138 0.2
139 0.23
140 0.22
141 0.19
142 0.2
143 0.24
144 0.25
145 0.27
146 0.27
147 0.25
148 0.27
149 0.36
150 0.43
151 0.47
152 0.57
153 0.65
154 0.74
155 0.8
156 0.87
157 0.89
158 0.9
159 0.92