Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A2G4SS40

Protein Details
Accession A0A2G4SS40   
Localization Confidence Medium
Confidence Score 11.5
NoLS Segment(s)
PositionSequenceProtein Nature
21-47IPKTRNTYCKGAKCRKHTPHKVTQYKAHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 17, cyto 5, mito 4
Family & Domain DBs
InterPro View protein in InterPro  
IPR000552  Ribosomal_L44e  
IPR011332  Ribosomal_zn-bd  
Gene Ontology GO:1990904  C:ribonucleoprotein complex  
GO:0005840  C:ribosome  
GO:0003735  F:structural constituent of ribosome  
GO:0006412  P:translation  
Pfam View protein in Pfam  
PF00935  Ribosomal_L44  
PROSITE View protein in PROSITE  
PS01172  RIBOSOMAL_L44E  
Amino Acid Sequences MDYQKLDAIQYDRYRYACVNIPKTRNTYCKGAKCRKHTPHKVTQYKAGKASLFAQGKRRYDRKQSGYGGQTKPIFHKKAKTTKKVVLRLECTSCKYKMQLALKRCKHFELGGDKKTKGAALVF
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.35
2 0.32
3 0.33
4 0.33
5 0.37
6 0.42
7 0.46
8 0.5
9 0.52
10 0.57
11 0.6
12 0.59
13 0.54
14 0.54
15 0.55
16 0.6
17 0.66
18 0.7
19 0.72
20 0.74
21 0.8
22 0.81
23 0.84
24 0.85
25 0.83
26 0.84
27 0.86
28 0.86
29 0.78
30 0.77
31 0.74
32 0.67
33 0.61
34 0.53
35 0.42
36 0.35
37 0.34
38 0.32
39 0.28
40 0.26
41 0.31
42 0.35
43 0.38
44 0.43
45 0.47
46 0.44
47 0.5
48 0.57
49 0.55
50 0.56
51 0.55
52 0.55
53 0.54
54 0.57
55 0.48
56 0.44
57 0.41
58 0.34
59 0.36
60 0.38
61 0.38
62 0.33
63 0.4
64 0.44
65 0.52
66 0.61
67 0.64
68 0.63
69 0.67
70 0.73
71 0.74
72 0.73
73 0.7
74 0.65
75 0.62
76 0.61
77 0.56
78 0.52
79 0.48
80 0.42
81 0.37
82 0.34
83 0.34
84 0.36
85 0.43
86 0.46
87 0.51
88 0.6
89 0.66
90 0.7
91 0.68
92 0.63
93 0.57
94 0.51
95 0.5
96 0.5
97 0.5
98 0.52
99 0.55
100 0.52
101 0.49
102 0.49
103 0.42