Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A2G4T8P3

Protein Details
Accession A0A2G4T8P3   
Localization Confidence High
Confidence Score 16.5
NoLS Segment(s)
PositionSequenceProtein Nature
5-49NQQQQQRQGGFKRKRNNNAEAPESSSKIKKRIRDINRTLNKKNKDHydrophilic
NLS Segment(s)
PositionSequence
18-18K
30-37SKIKKRIR
Subcellular Location(s) nucl 24.5, cyto_nucl 13
Family & Domain DBs
InterPro View protein in InterPro  
IPR019310  Efg1  
Gene Ontology GO:0006364  P:rRNA processing  
Pfam View protein in Pfam  
PF10153  Efg1  
Amino Acid Sequences MAFVNQQQQQRQGGFKRKRNNNAEAPESSSKIKKRIRDINRTLNKKNKDTLSAQAIIELKRKLRTLQYELGERVIDDKEQKMATKYHAVKHFERKKTERKINQIEKQLKEESDSEKKKELQVKLEEFKLNMLYIRNYPKTVPYVSLYPKGNENDEKSVARKQRILQEIKTALEKGDKSLREFTKSYRDKYREKLIKQGIIIIEPLAEDEEQQQEEKEDEDDFFEK
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.61
2 0.66
3 0.71
4 0.76
5 0.83
6 0.83
7 0.83
8 0.81
9 0.78
10 0.76
11 0.67
12 0.64
13 0.57
14 0.52
15 0.47
16 0.44
17 0.41
18 0.45
19 0.48
20 0.48
21 0.54
22 0.62
23 0.69
24 0.73
25 0.78
26 0.79
27 0.84
28 0.85
29 0.83
30 0.82
31 0.79
32 0.73
33 0.71
34 0.64
35 0.6
36 0.55
37 0.53
38 0.5
39 0.46
40 0.4
41 0.37
42 0.35
43 0.31
44 0.32
45 0.28
46 0.25
47 0.25
48 0.27
49 0.26
50 0.3
51 0.36
52 0.38
53 0.42
54 0.43
55 0.44
56 0.44
57 0.42
58 0.35
59 0.28
60 0.23
61 0.17
62 0.15
63 0.12
64 0.12
65 0.13
66 0.14
67 0.15
68 0.16
69 0.17
70 0.19
71 0.26
72 0.28
73 0.32
74 0.38
75 0.42
76 0.44
77 0.53
78 0.6
79 0.57
80 0.61
81 0.62
82 0.65
83 0.7
84 0.75
85 0.72
86 0.72
87 0.76
88 0.78
89 0.78
90 0.78
91 0.75
92 0.67
93 0.64
94 0.56
95 0.45
96 0.38
97 0.33
98 0.29
99 0.31
100 0.32
101 0.3
102 0.32
103 0.33
104 0.36
105 0.4
106 0.38
107 0.35
108 0.39
109 0.42
110 0.41
111 0.43
112 0.39
113 0.32
114 0.3
115 0.24
116 0.18
117 0.14
118 0.12
119 0.11
120 0.14
121 0.2
122 0.21
123 0.21
124 0.21
125 0.23
126 0.25
127 0.24
128 0.23
129 0.19
130 0.22
131 0.25
132 0.3
133 0.29
134 0.26
135 0.3
136 0.29
137 0.31
138 0.3
139 0.31
140 0.29
141 0.31
142 0.31
143 0.29
144 0.35
145 0.37
146 0.36
147 0.37
148 0.36
149 0.42
150 0.49
151 0.52
152 0.47
153 0.49
154 0.49
155 0.46
156 0.44
157 0.36
158 0.28
159 0.28
160 0.26
161 0.22
162 0.27
163 0.27
164 0.29
165 0.37
166 0.39
167 0.39
168 0.4
169 0.4
170 0.44
171 0.48
172 0.5
173 0.52
174 0.56
175 0.57
176 0.63
177 0.7
178 0.68
179 0.65
180 0.7
181 0.67
182 0.66
183 0.6
184 0.58
185 0.48
186 0.39
187 0.37
188 0.27
189 0.19
190 0.13
191 0.13
192 0.09
193 0.08
194 0.08
195 0.09
196 0.13
197 0.14
198 0.15
199 0.15
200 0.15
201 0.16
202 0.16
203 0.15
204 0.13
205 0.12