Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A2G4SM09

Protein Details
Accession A0A2G4SM09   
Localization Confidence Medium
Confidence Score 11.2
NoLS Segment(s)
PositionSequenceProtein Nature
1-27MNSVKEQKCVTRNRKERNRQSQAAFRFHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 22.5, cyto_nucl 13.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR004827  bZIP  
IPR046347  bZIP_sf  
Gene Ontology GO:0003700  F:DNA-binding transcription factor activity  
PROSITE View protein in PROSITE  
PS00036  BZIP_BASIC  
Amino Acid Sequences MNSVKEQKCVTRNRKERNRQSQAAFRFRRKKYIKELEESIMRMNNSNKRLNQELERTVHRAEKAERQCLELYEELHSLRKLTNRLFEENKQLTQYCSSMTANPLFISHNMVSNDHIGKSFK
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.85
2 0.88
3 0.91
4 0.92
5 0.92
6 0.87
7 0.84
8 0.82
9 0.8
10 0.79
11 0.75
12 0.73
13 0.74
14 0.69
15 0.73
16 0.69
17 0.68
18 0.69
19 0.73
20 0.68
21 0.64
22 0.66
23 0.59
24 0.57
25 0.5
26 0.4
27 0.32
28 0.27
29 0.23
30 0.25
31 0.27
32 0.29
33 0.33
34 0.33
35 0.35
36 0.38
37 0.39
38 0.38
39 0.37
40 0.37
41 0.34
42 0.35
43 0.33
44 0.3
45 0.3
46 0.26
47 0.23
48 0.21
49 0.27
50 0.29
51 0.33
52 0.33
53 0.33
54 0.33
55 0.31
56 0.31
57 0.24
58 0.2
59 0.16
60 0.16
61 0.14
62 0.15
63 0.15
64 0.12
65 0.13
66 0.16
67 0.19
68 0.2
69 0.28
70 0.3
71 0.35
72 0.4
73 0.4
74 0.46
75 0.45
76 0.44
77 0.39
78 0.36
79 0.32
80 0.3
81 0.28
82 0.19
83 0.2
84 0.19
85 0.19
86 0.22
87 0.22
88 0.2
89 0.19
90 0.19
91 0.17
92 0.17
93 0.21
94 0.18
95 0.22
96 0.22
97 0.23
98 0.24
99 0.27
100 0.28
101 0.23