Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A2G4SNY3

Protein Details
Accession A0A2G4SNY3   
Localization Confidence Low
Confidence Score 9.4
NoLS Segment(s)
PositionSequenceProtein Nature
6-25IPYILQRKCKDRNGIRITKEHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 11, mito 6, cyto 5, pero 3
Family & Domain DBs
InterPro View protein in InterPro  
IPR033472  RMI1-like_N_hel  
IPR013894  RMI1_N  
IPR042470  RMI1_N_C_sf  
Pfam View protein in Pfam  
PF08585  RMI1_N  
Amino Acid Sequences MSVDNIPYILQRKCKDRNGIRITKEYLQSFWSQGQRRPAPDTEEAYNQLVQDFLNKDIALTSEPVIPENFGQNSIETFPQGHLRHGGGVVLQIQDTIDIRYSTLSLLNNLTNATPVRQIYIERNKDDEVDFQRGMLRWTLSDGKNQIQAMEMETIPELSLTTPFGCK
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.57
2 0.64
3 0.68
4 0.75
5 0.76
6 0.8
7 0.77
8 0.75
9 0.72
10 0.66
11 0.63
12 0.54
13 0.45
14 0.39
15 0.36
16 0.32
17 0.32
18 0.35
19 0.33
20 0.36
21 0.44
22 0.46
23 0.48
24 0.51
25 0.48
26 0.45
27 0.46
28 0.45
29 0.38
30 0.37
31 0.36
32 0.32
33 0.3
34 0.24
35 0.2
36 0.16
37 0.13
38 0.13
39 0.12
40 0.11
41 0.13
42 0.13
43 0.12
44 0.12
45 0.13
46 0.1
47 0.1
48 0.1
49 0.09
50 0.1
51 0.11
52 0.1
53 0.1
54 0.1
55 0.11
56 0.11
57 0.09
58 0.1
59 0.09
60 0.1
61 0.11
62 0.1
63 0.08
64 0.08
65 0.08
66 0.15
67 0.16
68 0.15
69 0.16
70 0.16
71 0.16
72 0.16
73 0.15
74 0.07
75 0.07
76 0.08
77 0.06
78 0.06
79 0.05
80 0.05
81 0.05
82 0.06
83 0.06
84 0.06
85 0.06
86 0.06
87 0.06
88 0.07
89 0.07
90 0.09
91 0.09
92 0.09
93 0.11
94 0.11
95 0.11
96 0.11
97 0.11
98 0.1
99 0.1
100 0.1
101 0.11
102 0.11
103 0.12
104 0.13
105 0.15
106 0.22
107 0.32
108 0.37
109 0.36
110 0.39
111 0.38
112 0.39
113 0.38
114 0.36
115 0.31
116 0.31
117 0.29
118 0.26
119 0.29
120 0.28
121 0.28
122 0.24
123 0.19
124 0.13
125 0.18
126 0.25
127 0.23
128 0.29
129 0.31
130 0.32
131 0.36
132 0.36
133 0.31
134 0.26
135 0.26
136 0.22
137 0.22
138 0.18
139 0.14
140 0.14
141 0.14
142 0.12
143 0.11
144 0.09
145 0.06
146 0.08
147 0.09