Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A2G4T3M5

Protein Details
Accession A0A2G4T3M5   
Localization Confidence Medium
Confidence Score 11.4
NoLS Segment(s)
PositionSequenceProtein Nature
24-46NEKRQERIIRYLKKKRAVRQSWQHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 23.5, mito_nucl 13.5
Family & Domain DBs
Gene Ontology GO:0016020  C:membrane  
CDD cd04301  NAT_SF  
Amino Acid Sequences MTRIREYENSDLNRAKEFYINMENEKRQERIIRYLKKKRAVRQSWQLGIMGLVGLQLMRRTSWSTMFIEMTIWTTSIGLIWYLHIRDEYRKEIKKQADEMVDALKSKESHCWIMENGKDIVGTVILKCDQREGKIGYLTGVNSEIRRSLVKNAIQFAKSNKIEVISKWDESTKWTSDNNHL
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.41
2 0.35
3 0.3
4 0.28
5 0.28
6 0.32
7 0.33
8 0.34
9 0.4
10 0.41
11 0.42
12 0.45
13 0.4
14 0.36
15 0.41
16 0.4
17 0.43
18 0.5
19 0.56
20 0.63
21 0.72
22 0.77
23 0.79
24 0.82
25 0.81
26 0.82
27 0.8
28 0.79
29 0.79
30 0.79
31 0.73
32 0.67
33 0.58
34 0.47
35 0.39
36 0.29
37 0.18
38 0.09
39 0.05
40 0.04
41 0.03
42 0.03
43 0.04
44 0.05
45 0.05
46 0.06
47 0.09
48 0.11
49 0.13
50 0.16
51 0.17
52 0.18
53 0.19
54 0.17
55 0.15
56 0.14
57 0.14
58 0.1
59 0.09
60 0.07
61 0.07
62 0.06
63 0.06
64 0.06
65 0.04
66 0.04
67 0.05
68 0.06
69 0.06
70 0.06
71 0.07
72 0.08
73 0.11
74 0.14
75 0.2
76 0.26
77 0.3
78 0.32
79 0.39
80 0.43
81 0.43
82 0.43
83 0.41
84 0.36
85 0.33
86 0.31
87 0.25
88 0.21
89 0.17
90 0.14
91 0.12
92 0.1
93 0.1
94 0.14
95 0.15
96 0.17
97 0.18
98 0.2
99 0.19
100 0.24
101 0.25
102 0.23
103 0.21
104 0.18
105 0.17
106 0.15
107 0.14
108 0.1
109 0.09
110 0.06
111 0.07
112 0.09
113 0.1
114 0.1
115 0.15
116 0.16
117 0.18
118 0.23
119 0.24
120 0.25
121 0.27
122 0.27
123 0.22
124 0.22
125 0.2
126 0.16
127 0.15
128 0.13
129 0.11
130 0.12
131 0.12
132 0.13
133 0.15
134 0.16
135 0.2
136 0.26
137 0.3
138 0.33
139 0.38
140 0.41
141 0.4
142 0.41
143 0.39
144 0.42
145 0.38
146 0.36
147 0.31
148 0.3
149 0.31
150 0.3
151 0.35
152 0.29
153 0.3
154 0.3
155 0.32
156 0.29
157 0.32
158 0.36
159 0.31
160 0.3
161 0.32