Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A2G4T1Z3

Protein Details
Accession A0A2G4T1Z3    Localization Confidence Low Confidence Score 7.9
NoLS Segment(s)
PositionSequenceProtein Nature
21-40IEAIRKRKENDKMRPPESRYBasic
NLS Segment(s)
Subcellular Location(s) cyto_nucl 11.5, nucl 11, cyto 10, pero 3, cysk 3
Family & Domain DBs
InterPro View protein in InterPro  
IPR009737  Aim32/Apd1-like  
IPR036249  Thioredoxin-like_sf  
Pfam View protein in Pfam  
PF06999  Suc_Fer-like  
CDD cd03062  TRX_Fd_Sucrase  
Amino Acid Sequences MTGKSNWPAHIEDEGLAGAFIEAIRKRKENDKMRPPESRYHPAFYASSEKDDCHRIIVTNASLPSKYSYQHKGTDVLLLPDNVIFSNITPRRVNALLDYIFGKPCSQAFSVYPCPYSSLVLVCGHGNKDRRCGTIGPMLQKSLQQAASQDEEGNHVQIALSSHLGGHAFAGNVVIYTHHGQRAIWYGRVTPCYCKDIVDNTLEDNKVIEDLVRGIFEVRSKPSKCHKALEW
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.19
2 0.15
3 0.13
4 0.09
5 0.07
6 0.06
7 0.05
8 0.09
9 0.12
10 0.18
11 0.22
12 0.25
13 0.29
14 0.38
15 0.48
16 0.54
17 0.62
18 0.67
19 0.73
20 0.76
21 0.82
22 0.77
23 0.77
24 0.74
25 0.73
26 0.66
27 0.61
28 0.56
29 0.5
30 0.46
31 0.4
32 0.4
33 0.32
34 0.32
35 0.28
36 0.28
37 0.27
38 0.31
39 0.28
40 0.22
41 0.22
42 0.18
43 0.19
44 0.21
45 0.2
46 0.2
47 0.21
48 0.19
49 0.18
50 0.18
51 0.19
52 0.17
53 0.18
54 0.2
55 0.26
56 0.29
57 0.33
58 0.34
59 0.34
60 0.32
61 0.36
62 0.31
63 0.26
64 0.23
65 0.18
66 0.17
67 0.14
68 0.14
69 0.09
70 0.08
71 0.06
72 0.05
73 0.15
74 0.16
75 0.2
76 0.2
77 0.21
78 0.24
79 0.25
80 0.25
81 0.17
82 0.2
83 0.17
84 0.17
85 0.18
86 0.15
87 0.14
88 0.14
89 0.13
90 0.09
91 0.09
92 0.11
93 0.1
94 0.11
95 0.11
96 0.17
97 0.22
98 0.23
99 0.23
100 0.2
101 0.21
102 0.2
103 0.2
104 0.15
105 0.1
106 0.11
107 0.1
108 0.11
109 0.09
110 0.1
111 0.1
112 0.14
113 0.2
114 0.19
115 0.25
116 0.27
117 0.28
118 0.3
119 0.29
120 0.29
121 0.3
122 0.32
123 0.3
124 0.29
125 0.28
126 0.26
127 0.27
128 0.25
129 0.2
130 0.18
131 0.14
132 0.14
133 0.16
134 0.18
135 0.17
136 0.16
137 0.13
138 0.15
139 0.15
140 0.15
141 0.12
142 0.09
143 0.08
144 0.09
145 0.1
146 0.08
147 0.08
148 0.07
149 0.07
150 0.08
151 0.08
152 0.07
153 0.07
154 0.07
155 0.06
156 0.06
157 0.07
158 0.06
159 0.06
160 0.06
161 0.05
162 0.07
163 0.1
164 0.12
165 0.13
166 0.14
167 0.14
168 0.16
169 0.25
170 0.25
171 0.26
172 0.25
173 0.27
174 0.31
175 0.37
176 0.36
177 0.34
178 0.35
179 0.36
180 0.35
181 0.32
182 0.32
183 0.32
184 0.33
185 0.31
186 0.27
187 0.27
188 0.32
189 0.31
190 0.27
191 0.22
192 0.19
193 0.16
194 0.15
195 0.12
196 0.08
197 0.09
198 0.11
199 0.1
200 0.1
201 0.11
202 0.12
203 0.15
204 0.18
205 0.22
206 0.3
207 0.32
208 0.39
209 0.49
210 0.58
211 0.6