Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A2G4SJ90

Protein Details
Accession A0A2G4SJ90    Localization Confidence Medium Confidence Score 13.6
NoLS Segment(s)
PositionSequenceProtein Nature
58-80ATVCYLKKAKKRKSIALEQNKTSHydrophilic
NLS Segment(s)
PositionSequence
65-69KAKKR
Subcellular Location(s) nucl 22, cyto_nucl 13, mito 2, cyto 2
Family & Domain DBs
Amino Acid Sequences MGFIEKLRTQYELHQVNKYTRRRETQSDFEFKNKDYYKANYQNGIYISAPQKIYLWTATVCYLKKAKKRKSIALEQNKTSESYTNL
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.42
2 0.44
3 0.5
4 0.57
5 0.59
6 0.57
7 0.55
8 0.59
9 0.6
10 0.65
11 0.64
12 0.65
13 0.65
14 0.65
15 0.6
16 0.57
17 0.54
18 0.46
19 0.47
20 0.39
21 0.34
22 0.31
23 0.33
24 0.38
25 0.45
26 0.46
27 0.4
28 0.39
29 0.39
30 0.36
31 0.33
32 0.24
33 0.18
34 0.18
35 0.18
36 0.17
37 0.15
38 0.15
39 0.13
40 0.15
41 0.12
42 0.12
43 0.09
44 0.1
45 0.13
46 0.16
47 0.16
48 0.18
49 0.24
50 0.29
51 0.37
52 0.46
53 0.54
54 0.6
55 0.68
56 0.74
57 0.77
58 0.81
59 0.84
60 0.85
61 0.83
62 0.76
63 0.73
64 0.64
65 0.57
66 0.47