Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A2G4SIE3

Protein Details
Accession A0A2G4SIE3    Localization Confidence Medium Confidence Score 14.6
NoLS Segment(s)
PositionSequenceProtein Nature
154-207YPISRLPKPKIKKNIFKRKREEPKDEMIAHPFKRPKLSRRQKKKLKVAEQKEEEBasic
288-312IHRIATSIYKRHRRNKPCHLFNIIFHydrophilic
NLS Segment(s)
PositionSequence
158-200RLPKPKIKKNIFKRKREEPKDEMIAHPFKRPKLSRRQKKKLKV
Subcellular Location(s) nucl 17.5, mito_nucl 13, mito 7.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR021891  Telomerase_RBD  
IPR003545  Telomerase_RT  
Gene Ontology GO:0000781  C:chromosome, telomeric region  
GO:0005634  C:nucleus  
GO:0003677  F:DNA binding  
GO:0046872  F:metal ion binding  
GO:0003721  F:telomerase RNA reverse transcriptase activity  
Pfam View protein in Pfam  
PF12009  Telomerase_RBD  
Amino Acid Sequences MRKLPKYFYSSFERVQNLKEYFGDALDLRNNHELLTLAKRIVIITPHDRKCYSTMWQKDRHYNKTIVLELNKFLDELQYFAARQQNFLHVLFVSRSLKSLTGECTNTAMNEFKTNKAWAQLFEQVGPRAFGELILDHIVITRLSGGGYFQISGYPISRLPKPKIKKNIFKRKREEPKDEMIAHPFKRPKLSRRQKKKLKVAEQKEEEKHTTKQPIPDELFINRRSIRYILSEIKDIDGEMMAQSSDNDRGLKEKIVDFLKHIFPEEFSTKNRKASMQRRRFLQKYQSIHRIATSIYKRHRRNKPCHLFNIIFPRKEFGGDVMDMVLPHGKVILFIKTQLKNVFPLEFWGSQHNFDVVCRAVKCYVSRNMYEKLSLSEVLHQFKVSCFNCPP
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.48
2 0.49
3 0.52
4 0.45
5 0.42
6 0.38
7 0.34
8 0.28
9 0.26
10 0.25
11 0.16
12 0.18
13 0.21
14 0.21
15 0.22
16 0.26
17 0.26
18 0.23
19 0.23
20 0.21
21 0.19
22 0.25
23 0.23
24 0.19
25 0.2
26 0.21
27 0.2
28 0.22
29 0.21
30 0.21
31 0.28
32 0.38
33 0.42
34 0.47
35 0.47
36 0.47
37 0.48
38 0.46
39 0.45
40 0.45
41 0.5
42 0.54
43 0.62
44 0.66
45 0.73
46 0.77
47 0.76
48 0.72
49 0.66
50 0.63
51 0.6
52 0.58
53 0.53
54 0.49
55 0.44
56 0.4
57 0.38
58 0.33
59 0.26
60 0.22
61 0.2
62 0.15
63 0.14
64 0.14
65 0.14
66 0.14
67 0.17
68 0.23
69 0.19
70 0.21
71 0.22
72 0.25
73 0.26
74 0.26
75 0.24
76 0.18
77 0.2
78 0.19
79 0.22
80 0.2
81 0.16
82 0.17
83 0.17
84 0.19
85 0.18
86 0.2
87 0.19
88 0.21
89 0.22
90 0.22
91 0.22
92 0.21
93 0.2
94 0.2
95 0.18
96 0.14
97 0.2
98 0.21
99 0.21
100 0.24
101 0.26
102 0.25
103 0.28
104 0.28
105 0.23
106 0.25
107 0.29
108 0.27
109 0.27
110 0.29
111 0.25
112 0.24
113 0.23
114 0.19
115 0.14
116 0.13
117 0.11
118 0.09
119 0.07
120 0.09
121 0.09
122 0.09
123 0.07
124 0.08
125 0.08
126 0.07
127 0.07
128 0.05
129 0.04
130 0.04
131 0.04
132 0.04
133 0.05
134 0.06
135 0.06
136 0.06
137 0.06
138 0.07
139 0.07
140 0.08
141 0.08
142 0.1
143 0.12
144 0.17
145 0.22
146 0.27
147 0.35
148 0.41
149 0.48
150 0.57
151 0.64
152 0.7
153 0.76
154 0.82
155 0.83
156 0.86
157 0.84
158 0.84
159 0.86
160 0.84
161 0.81
162 0.75
163 0.72
164 0.69
165 0.63
166 0.53
167 0.48
168 0.45
169 0.38
170 0.38
171 0.34
172 0.29
173 0.36
174 0.39
175 0.41
176 0.47
177 0.57
178 0.63
179 0.71
180 0.8
181 0.82
182 0.88
183 0.9
184 0.89
185 0.88
186 0.88
187 0.84
188 0.83
189 0.78
190 0.75
191 0.68
192 0.62
193 0.54
194 0.47
195 0.42
196 0.38
197 0.39
198 0.34
199 0.37
200 0.36
201 0.4
202 0.38
203 0.38
204 0.35
205 0.31
206 0.33
207 0.29
208 0.3
209 0.25
210 0.23
211 0.22
212 0.21
213 0.2
214 0.18
215 0.22
216 0.24
217 0.25
218 0.26
219 0.25
220 0.24
221 0.23
222 0.19
223 0.15
224 0.09
225 0.07
226 0.05
227 0.05
228 0.04
229 0.04
230 0.04
231 0.06
232 0.07
233 0.08
234 0.09
235 0.08
236 0.11
237 0.13
238 0.14
239 0.15
240 0.15
241 0.19
242 0.22
243 0.23
244 0.22
245 0.25
246 0.26
247 0.25
248 0.25
249 0.2
250 0.18
251 0.22
252 0.23
253 0.22
254 0.22
255 0.3
256 0.31
257 0.35
258 0.36
259 0.37
260 0.44
261 0.52
262 0.6
263 0.62
264 0.63
265 0.66
266 0.73
267 0.71
268 0.69
269 0.69
270 0.66
271 0.63
272 0.67
273 0.68
274 0.62
275 0.59
276 0.52
277 0.43
278 0.35
279 0.36
280 0.34
281 0.33
282 0.4
283 0.49
284 0.57
285 0.66
286 0.76
287 0.77
288 0.82
289 0.86
290 0.88
291 0.87
292 0.85
293 0.83
294 0.74
295 0.7
296 0.71
297 0.66
298 0.57
299 0.49
300 0.45
301 0.37
302 0.37
303 0.31
304 0.22
305 0.2
306 0.18
307 0.18
308 0.16
309 0.15
310 0.14
311 0.14
312 0.14
313 0.09
314 0.09
315 0.09
316 0.08
317 0.1
318 0.12
319 0.16
320 0.14
321 0.19
322 0.27
323 0.29
324 0.34
325 0.36
326 0.36
327 0.35
328 0.37
329 0.35
330 0.27
331 0.29
332 0.29
333 0.28
334 0.27
335 0.31
336 0.3
337 0.3
338 0.31
339 0.28
340 0.23
341 0.21
342 0.24
343 0.19
344 0.22
345 0.21
346 0.23
347 0.24
348 0.28
349 0.31
350 0.34
351 0.41
352 0.41
353 0.46
354 0.48
355 0.5
356 0.49
357 0.48
358 0.42
359 0.37
360 0.34
361 0.31
362 0.28
363 0.31
364 0.34
365 0.36
366 0.35
367 0.32
368 0.3
369 0.29
370 0.38
371 0.3