Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A2G4T964

Protein Details
Accession A0A2G4T964   
Localization Confidence High
Confidence Score 15.4
NoLS Segment(s)
PositionSequenceProtein Nature
101-120EPEPKRKKAKVDTKNNIEKNBasic
NLS Segment(s)
PositionSequence
104-142PKRKKAKVDTKNNIEKNKKEKVGEKENIKVAEKRRDRDQ
146-149SKRR
Subcellular Location(s) nucl 19.5, cyto_nucl 10.5, mito 6
Family & Domain DBs
InterPro View protein in InterPro  
IPR041232  NPL  
Gene Ontology GO:0016853  F:isomerase activity  
Pfam View protein in Pfam  
PF17800  NPL  
Amino Acid Sequences MKIQGIYGITVRPRSRITIKSGGSFQLTMASLRSFKSLERTSLYVETKKQKILLCSLIPCTRDQQLLNFTRLEGETVTFVIKGKNTVQLSGNYISLEDEPEPEPKRKKAKVDTKNNIEKNKKEKVGEKENIKVAEKRRDRDQQTESKRRGHAIDEKQVKTPESKRHDKATQDDRTVENKNQLKIKRHNQAVQDEAKQVKNKANEKVLQDEHIVDDIVSILKARGEPSEEDEDETITDVNSDTDDEYAE
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.35
2 0.41
3 0.42
4 0.47
5 0.49
6 0.51
7 0.51
8 0.52
9 0.48
10 0.43
11 0.38
12 0.3
13 0.25
14 0.23
15 0.19
16 0.18
17 0.17
18 0.16
19 0.16
20 0.19
21 0.15
22 0.15
23 0.23
24 0.25
25 0.27
26 0.3
27 0.31
28 0.33
29 0.39
30 0.42
31 0.37
32 0.4
33 0.44
34 0.44
35 0.44
36 0.45
37 0.42
38 0.41
39 0.42
40 0.42
41 0.37
42 0.37
43 0.39
44 0.38
45 0.36
46 0.34
47 0.31
48 0.28
49 0.27
50 0.25
51 0.25
52 0.3
53 0.33
54 0.33
55 0.31
56 0.28
57 0.26
58 0.26
59 0.22
60 0.14
61 0.11
62 0.09
63 0.09
64 0.1
65 0.08
66 0.08
67 0.09
68 0.09
69 0.11
70 0.11
71 0.18
72 0.18
73 0.2
74 0.22
75 0.22
76 0.25
77 0.24
78 0.23
79 0.16
80 0.15
81 0.14
82 0.12
83 0.12
84 0.08
85 0.09
86 0.09
87 0.14
88 0.17
89 0.21
90 0.25
91 0.3
92 0.39
93 0.42
94 0.49
95 0.54
96 0.62
97 0.67
98 0.75
99 0.77
100 0.77
101 0.82
102 0.79
103 0.77
104 0.72
105 0.67
106 0.62
107 0.61
108 0.55
109 0.49
110 0.51
111 0.5
112 0.55
113 0.55
114 0.52
115 0.49
116 0.48
117 0.48
118 0.43
119 0.39
120 0.35
121 0.39
122 0.4
123 0.39
124 0.43
125 0.5
126 0.52
127 0.55
128 0.57
129 0.57
130 0.62
131 0.69
132 0.65
133 0.62
134 0.6
135 0.54
136 0.49
137 0.44
138 0.43
139 0.41
140 0.46
141 0.48
142 0.48
143 0.5
144 0.49
145 0.45
146 0.42
147 0.41
148 0.42
149 0.42
150 0.49
151 0.49
152 0.56
153 0.6
154 0.59
155 0.61
156 0.61
157 0.6
158 0.55
159 0.53
160 0.49
161 0.49
162 0.48
163 0.42
164 0.41
165 0.39
166 0.4
167 0.44
168 0.47
169 0.51
170 0.57
171 0.64
172 0.64
173 0.67
174 0.68
175 0.67
176 0.67
177 0.64
178 0.59
179 0.53
180 0.48
181 0.45
182 0.44
183 0.42
184 0.38
185 0.38
186 0.42
187 0.45
188 0.47
189 0.51
190 0.51
191 0.51
192 0.57
193 0.53
194 0.47
195 0.42
196 0.36
197 0.3
198 0.26
199 0.22
200 0.14
201 0.12
202 0.1
203 0.09
204 0.08
205 0.07
206 0.06
207 0.07
208 0.08
209 0.1
210 0.11
211 0.14
212 0.16
213 0.22
214 0.29
215 0.29
216 0.3
217 0.29
218 0.28
219 0.25
220 0.24
221 0.18
222 0.1
223 0.1
224 0.08
225 0.08
226 0.07
227 0.08
228 0.08