Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A1X2H3W9

Protein Details
Accession A0A1X2H3W9    Localization Confidence High Confidence Score 15
NoLS Segment(s)
PositionSequenceProtein Nature
66-85KEKMEKEKEDFYKRRKNGKEBasic
NLS Segment(s)
PositionSequence
66-74KEKMEKEKE
76-83FYKRRKNG
Subcellular Location(s) nucl 20.5, cyto_nucl 14, cyto 6.5
Family & Domain DBs
Amino Acid Sequences LHSNVIAPEEFEFVENFKNFDVTIPTVIPVWLWGGAPTFRKHSCLRLKFLNPDMMTEEEREIRDRKEKMEKEKEDFYKRRKNGKED
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.17
2 0.16
3 0.16
4 0.14
5 0.14
6 0.14
7 0.14
8 0.17
9 0.13
10 0.14
11 0.14
12 0.14
13 0.14
14 0.13
15 0.12
16 0.08
17 0.08
18 0.06
19 0.06
20 0.06
21 0.07
22 0.09
23 0.12
24 0.13
25 0.16
26 0.16
27 0.2
28 0.21
29 0.29
30 0.37
31 0.38
32 0.41
33 0.44
34 0.47
35 0.47
36 0.49
37 0.48
38 0.38
39 0.35
40 0.34
41 0.29
42 0.27
43 0.23
44 0.22
45 0.17
46 0.18
47 0.2
48 0.19
49 0.2
50 0.27
51 0.28
52 0.32
53 0.41
54 0.47
55 0.54
56 0.63
57 0.66
58 0.64
59 0.72
60 0.74
61 0.74
62 0.76
63 0.75
64 0.75
65 0.76
66 0.81