Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A1X2HD86

Protein Details
Accession A0A1X2HD86    Localization Confidence Medium Confidence Score 10.8
NoLS Segment(s)
PositionSequenceProtein Nature
80-109RVIPLPQTPPPRRSRRPRLPCRILPRPPSCHydrophilic
NLS Segment(s)
PositionSequence
90-96PRRSRRP
Subcellular Location(s) mito 11, nucl 7, extr 5, plas 2
Family & Domain DBs
Amino Acid Sequences MFPLQVVSQTLPQVVRNPPLLTLFLLPLLLQTLQRQILQHQTLLQVILLHLHKIPLHLKYRQRRKTLPLHKSLLHLRYPRVIPLPQTPPPRRSRRPRLPCRILPRPPSC
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.25
2 0.27
3 0.28
4 0.28
5 0.27
6 0.28
7 0.27
8 0.23
9 0.2
10 0.17
11 0.13
12 0.13
13 0.11
14 0.09
15 0.09
16 0.08
17 0.07
18 0.08
19 0.11
20 0.12
21 0.14
22 0.14
23 0.15
24 0.22
25 0.22
26 0.22
27 0.2
28 0.19
29 0.18
30 0.18
31 0.16
32 0.09
33 0.07
34 0.1
35 0.09
36 0.08
37 0.08
38 0.09
39 0.09
40 0.1
41 0.12
42 0.14
43 0.18
44 0.24
45 0.32
46 0.41
47 0.52
48 0.58
49 0.63
50 0.62
51 0.65
52 0.7
53 0.72
54 0.71
55 0.68
56 0.64
57 0.59
58 0.59
59 0.59
60 0.52
61 0.48
62 0.43
63 0.37
64 0.39
65 0.38
66 0.36
67 0.34
68 0.32
69 0.29
70 0.33
71 0.38
72 0.4
73 0.49
74 0.51
75 0.55
76 0.63
77 0.7
78 0.72
79 0.77
80 0.81
81 0.82
82 0.88
83 0.91
84 0.92
85 0.92
86 0.92
87 0.91
88 0.9
89 0.88